SecReT6
Protein ID: 346726874
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_4009
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4642438..4643445 [-]
Producthypothetical protein
NoteTssG
UniProt IDG2LYP2
KEGG IDxax:XACM_4009
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.80E-104, Aligned region: 14..318
Protein Sequence: 335 a.a.     [Download]
>gi|346726874|ref|YP_004853543.1| hypothetical protein XACM_4009 [Xanthomonas axonopodis pv. citrumelo F1]
MSAAAAALAQALQTRPQDFSPFAALRAIERCHPLQPRLGESTRASDDVLRLRHAPSLAFAPHALDRYTPA
THDQPAALYGLFLGLFGPNAPLPLHLTEYAIERAQQAKDGTFAAFADVFHHRMLSLFYRAWAQAQPSVQA
ERPASDQFRAWLDALVGIASPHLRDRDALPDDARRYYAGRLGTATRTPEGLRALLQQLCEWPVQVQEFIT
EWMRLPADAHLQLGLGPRNARLGVDSVVGAHVRGAQQRVRICLGPLPRLAFQRFLPGGQALRQLTAAVRS
YLGDEFGWELQLLLKADEVPTPHLARNSRLGLDTWLGRRAGSIADADEVLLRPSG
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4643445-4642438 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
GTGAGCGCGGCGGCTGCGGCGCTGGCCCAGGCGCTGCAGACCCGGCCACAGGATTTCAGCCCGTTCGCGG
CCTTGCGCGCGATCGAGCGCTGCCATCCGTTGCAGCCACGCCTGGGTGAATCCACGCGCGCCAGCGACGA
TGTGCTGCGGCTGCGGCATGCGCCATCACTGGCATTCGCACCCCATGCGCTGGACCGCTACACACCGGCA
ACGCACGATCAGCCTGCCGCGCTGTACGGTCTGTTTTTAGGCCTGTTCGGTCCCAATGCACCATTGCCCT
TGCACCTGACCGAATACGCCATCGAGCGTGCGCAGCAAGCCAAGGATGGCACCTTTGCCGCATTTGCCGA
TGTGTTCCACCACCGCATGCTGAGCCTGTTCTACCGCGCCTGGGCGCAGGCACAGCCCAGCGTGCAGGCC
GAGCGCCCGGCGAGCGACCAGTTCCGTGCCTGGCTGGATGCACTGGTCGGCATCGCCAGCCCGCATCTGC
GCGACCGCGACGCGTTGCCGGACGATGCACGTCGTTACTACGCCGGCCGTCTTGGCACCGCCACGCGCAC
GCCGGAAGGTTTGCGTGCCCTGCTGCAGCAGTTGTGCGAATGGCCGGTGCAGGTACAGGAATTCATCACC
GAATGGATGCGCCTGCCGGCCGATGCGCACCTGCAACTTGGTCTGGGTCCGCGCAACGCGCGGCTGGGCG
TGGACAGCGTGGTGGGCGCACACGTGCGTGGCGCCCAGCAACGCGTGCGCATCTGCCTGGGGCCGCTGCC
GCGCCTGGCGTTTCAACGCTTTCTTCCGGGCGGCCAGGCGCTCAGGCAACTCACCGCTGCGGTGCGCAGC
TATCTGGGCGACGAATTCGGCTGGGAACTGCAGCTGTTGCTCAAGGCCGACGAGGTCCCCACGCCGCACC
TTGCGCGCAATAGCCGGCTGGGCCTGGACACCTGGCTCGGCCGCCGTGCCGGGAGCATTGCCGACGCCGA
CGAGGTGCTGCTGCGCCCATCGGGGTGA