SecReT6
Protein ID: 346726875
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_4010
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4643442..4645325 [-]
Producthypothetical protein
NoteTssF
UniProt IDG2LYP3
KEGG IDxax:XACM_4010
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-221, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|346726875|ref|YP_004853544.1| hypothetical protein XACM_4010 [Xanthomonas axonopodis pv. citrumelo F1]
MDPRLLPYYTRELQHVRDMGAEFAREYPKIAGRLGLDAFECADPYVERLLEGFAFLAARVQLKLDAQYPV
FTQHLLEMVYPHYLAPLPSMAVVQLQPDLKDSGLAAGVVVPRQSALRSLVGPGERTACEFRTAHAVSLWP
LQLAEVKYLESPAALAAAGIALPAGRVVRAGVRLRFELVGGAQTQALALDRLPLFLAGADGLPKRLYEQL
HADTTAVVVRGSNASGGMLEMTLGADTVQMRGFADDDALIPYDGRSFSGYRLLQEYFACPERFLFAELTG
LRAPLRRLHGSSFEVVVLLQRSLPSLAAAVGAEHFKLFCTPAINLFPRRADRIHLHAGLHEYHVLADRTR
PMDFEVHHLGEVEGFGDRQEPEQRFAPFYGGDARTWHARHGAFYSMRREPRMLSARQRRDGARSSYVGSE
VFVSLVDADDQPHSTRLRQLGLQLWCSNRDLPLHMPVGKGTTDFTMDSGVPVQSVRCVAGPTKPRPALSA
GQTAWRLLSQLQLNYLSLFEDGPDGAAALREILTLYCDPFDASAQRQIEGVKQVSGTPIVRRIPVPGPIT
FGRGLEITLTCEDAAFEGTGAFLLASVLRHFFARYVSVNSFTETVLRTTERNEVARWPAQPGTRPRL
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4645325-4643442 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGACCCGCGCCTGCTGCCGTACTACACCCGCGAATTGCAGCACGTGCGCGACATGGGCGCGGAGTTTG
CGCGCGAGTATCCCAAGATCGCCGGACGGCTCGGTCTGGACGCGTTCGAATGTGCCGACCCGTATGTCGA
GCGGTTGCTGGAAGGCTTCGCGTTCCTGGCCGCGCGCGTGCAACTCAAGCTGGACGCGCAGTACCCCGTG
TTCACCCAGCACCTGCTGGAGATGGTCTACCCGCATTATCTGGCGCCGCTGCCGTCGATGGCGGTGGTGC
AGTTGCAGCCGGATCTGAAAGACAGCGGGCTGGCAGCAGGCGTGGTGGTGCCGCGGCAAAGTGCGCTGCG
CAGCCTGGTCGGCCCGGGCGAGCGCACCGCCTGCGAATTTCGCACCGCGCATGCAGTGAGCTTGTGGCCG
TTGCAGCTGGCCGAGGTCAAGTATCTTGAATCGCCGGCCGCGTTGGCGGCTGCCGGCATCGCCTTGCCGG
CCGGGCGCGTGGTGCGTGCCGGCGTGCGTCTGCGCTTTGAGCTGGTGGGTGGTGCGCAGACGCAAGCGCT
GGCGCTGGATCGGCTGCCGCTGTTTCTGGCCGGCGCCGACGGCTTGCCCAAGCGCCTTTACGAACAACTG
CATGCCGATACCACCGCCGTGGTGGTGCGTGGCAGTAATGCCAGCGGTGGCATGCTGGAGATGACGCTGG
GCGCCGATACCGTGCAGATGCGCGGCTTTGCCGATGACGATGCATTGATTCCGTACGACGGCCGTTCGTT
CAGTGGTTACCGCCTGCTGCAGGAATACTTCGCCTGTCCGGAGCGCTTTCTGTTCGCAGAACTCACCGGG
CTGCGCGCGCCATTGCGGCGGTTGCACGGCAGCAGCTTCGAGGTGGTGGTGTTGCTGCAACGCAGCCTGC
CGAGCCTGGCTGCGGCAGTGGGCGCCGAGCATTTCAAATTGTTCTGCACCCCGGCAATCAATCTGTTCCC
ACGGCGTGCCGATCGCATCCATCTGCACGCCGGCCTGCACGAATACCACGTGCTGGCCGACCGCACCCGG
CCGATGGATTTCGAGGTCCATCATTTGGGCGAAGTGGAAGGCTTCGGCGATCGTCAGGAGCCGGAGCAAC
GCTTCGCGCCGTTCTATGGTGGCGACGCACGCACCTGGCATGCACGGCATGGCGCGTTCTACAGCATGCG
CCGCGAACCGCGCATGCTATCGGCCCGCCAGCGCCGCGATGGCGCGCGGTCGAGTTATGTGGGCAGCGAA
GTGTTCGTCAGCCTGGTCGATGCCGACGATCAGCCGCACAGCACGCGCCTGCGCCAGCTTGGGCTGCAAC
TGTGGTGCAGCAACCGCGATCTGCCGCTGCATATGCCGGTAGGCAAGGGCACCACCGATTTCACCATGGA
CAGCGGCGTGCCGGTCCAGAGCGTGCGCTGCGTGGCCGGGCCGACCAAGCCGCGCCCGGCGTTGTCGGCT
GGGCAGACTGCGTGGCGCCTGCTCAGCCAATTGCAGCTCAATTATCTCTCGCTCTTCGAAGACGGCCCCG
ACGGCGCCGCTGCGCTACGCGAGATCCTCACCTTGTACTGCGACCCGTTCGACGCATCCGCGCAGCGGCA
GATCGAAGGCGTCAAGCAGGTGAGCGGCACACCGATCGTGCGGCGTATCCCGGTGCCTGGCCCGATCACC
TTCGGTCGCGGCCTGGAGATCACGCTGACCTGCGAGGACGCCGCCTTCGAAGGCACCGGCGCCTTCCTGC
TGGCTTCGGTGCTGCGGCACTTCTTCGCGCGCTATGTCTCGGTGAATTCCTTCACCGAGACCGTGCTGCG
CACCACCGAACGCAACGAGGTGGCCCGATGGCCAGCCCAGCCCGGCACGCGCCCGCGCCTGTGA