SecReT6
Protein ID: 346726877
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_4012
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4645840..4646634 [-]
ProductProtein of avirulence locus involved in temperature-dependent protein secretion
NoteTagJ
UniProt IDG2LYP5
KEGG IDxax:XACM_4012
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.20E-43, Aligned region: 139..261
TPR_16 [PF13432], Evalue: 0.00026, Aligned region: 5..62
TPR_16 [PF13432], Evalue: 0.00026, Aligned region: 98..134
TPR_16 [PF13432], Evalue: 0.00026, Aligned region: 107..153
Protein Sequence: 264 a.a.     [Download]
>gi|346726877|ref|YP_004853546.1| Protein of avirulence locus involved in temperature-dependent protein secretion [Xanthomonas axonopodis pv. citrumelo F1]
MDATAQTLLAQGEPAQALQQLIQQVRRQPADAAQRVFLFQLLAVLGQWSRAADQLRACAELDAATLPLVQ
TYLAVLQGEQTRAEVFAGTRLPHVIGEPAEWLAMHLQALQLAAQGHGEQAAALRAQAFERAPTSAGVLDG
ERFQWLADADTRFGPCIELMLDSGYAWAPLSQIQQLRMQAPLDLRDTVWAPVSVLWRNGGQAFGYLPVRY
PGSEHLDAGELQLARRTEWTHGTQGEIGLGQRMWSTESHEIALLDVRDVQFDAG
 
Nucleotide Sequence: 795 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4646634-4645840 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGATGCCACCGCACAGACCCTGCTGGCCCAAGGCGAGCCGGCGCAGGCGTTGCAGCAACTGATCCAGC
AGGTGCGCCGGCAACCGGCCGATGCAGCGCAGCGCGTGTTCCTGTTTCAGTTGCTGGCCGTCCTCGGGCA
GTGGTCGCGCGCCGCAGATCAGCTGCGCGCCTGCGCTGAACTGGATGCCGCCACGCTGCCCTTGGTGCAG
ACGTACCTTGCAGTGCTGCAGGGCGAACAGACGCGCGCCGAGGTGTTTGCCGGCACGCGGCTACCGCATG
TGATTGGCGAACCGGCCGAGTGGCTGGCAATGCATCTGCAGGCGCTGCAACTGGCGGCGCAGGGCCATGG
CGAACAAGCTGCGGCGTTGCGGGCGCAGGCCTTCGAACGGGCACCCACCAGTGCCGGCGTGCTCGATGGC
GAACGCTTCCAGTGGCTTGCAGATGCCGATACCCGTTTCGGACCCTGCATCGAGCTCATGCTCGACAGCG
GCTATGCCTGGGCCCCGCTCAGTCAGATCCAGCAGCTGCGCATGCAAGCGCCGCTGGATCTGCGCGACAC
CGTGTGGGCGCCGGTGAGCGTGCTATGGCGCAACGGCGGCCAGGCCTTCGGCTACCTGCCGGTGCGTTAC
CCCGGCAGCGAGCACCTGGATGCCGGCGAGCTGCAACTGGCGCGCCGCACCGAATGGACCCACGGCACGC
AGGGCGAAATCGGCCTGGGCCAGCGCATGTGGAGCACGGAGTCGCACGAGATTGCGCTGCTCGATGTGCG
TGACGTGCAGTTCGACGCGGGCTGA