SecReT6
Protein ID: 346726878
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_4013
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4646838..4647341 [-]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDG2LYP6
KEGG IDxax:XACM_4013
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-33, Aligned region: 12..139
Protein Sequence: 167 a.a.     [Download]
>gi|346726878|ref|YP_004853547.1| hemolysin-coregulated protein [Xanthomonas axonopodis pv. citrumelo F1]
MAFDMHIKFGSGKVKIEGASNHKKHKGEIPILAWSWGASNSGDLHTGGGSASGGKAHIQDISITKYVDGC
SNALLDAVCTGARVENAWLYVTNATGEQSDFLTLELSEGVLITSLSTGGSGGEDRLTENVTLHFGKFKYG
FQPQDDKGAAQGGAKEFTYDIQGVAKA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4647341-4646838 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCGTTCGACATGCACATCAAGTTCGGCAGCGGCAAGGTCAAGATCGAAGGCGCGTCCAACCACAAGA
AGCACAAGGGCGAAATTCCGATCCTGGCCTGGTCTTGGGGCGCGAGCAATTCCGGCGACCTGCACACCGG
TGGCGGCTCGGCCAGCGGTGGCAAGGCGCATATCCAGGACATCTCCATCACAAAGTACGTGGATGGTTGC
TCCAACGCATTGCTCGATGCGGTATGCACCGGGGCACGTGTGGAAAACGCCTGGCTGTACGTCACCAACG
CCACTGGCGAGCAGAGCGACTTTCTCACCCTGGAATTGAGCGAAGGCGTGCTGATTACCTCGTTGTCGAC
CGGCGGTTCCGGCGGCGAAGACCGCCTGACCGAAAACGTGACGCTGCACTTCGGCAAGTTCAAGTACGGC
TTCCAGCCGCAGGACGACAAGGGTGCCGCCCAGGGTGGCGCGAAGGAATTCACCTACGACATCCAGGGTG
TGGCCAAGGCCTAA