SecReT6
Protein ID: 346726879
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_4014
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4647424..4648917 [-]
Producthypothetical protein
NoteTssC
UniProt IDG2LYP7
KEGG IDxax:XACM_4014
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.40E-194, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.00021, Aligned region: 20..59
BMFP [PF04380], Evalue: 0.00021, Aligned region: 60..90
Protein Sequence: 497 a.a.     [Download]
>gi|346726879|ref|YP_004853548.1| hypothetical protein XACM_4014 [Xanthomonas axonopodis pv. citrumelo F1]
MSATEAALATSSTETTEQGDFAALLNREFRPKSERAKEEVESAVRTLAEQVLNRSDVVSEDVSQTIKAYI
AEIDRALTEQLNQILHHADLQQLEGAWRGLHYLVNNTETDQQLKIRVLNISKKELGKVLKRYKGTAWDQS
PIFKKVYEQEYGQLGGEPYGCLVGDYYFDQSPPDVELLNGMAQVAAAAHAPFIAAAAPKLMGMDNWSELS
NPRDLAKIFSTPDYAAWRSLRESEDSKYIGLAMPRTLSRLPYGAATSTVDEFDFEEDTAGADSSKYTWQN
AAYAMAVNINRSFKQYGWCSRIRGIESGGAVEGLPTHTFPTDDGGVDMKCPTEVAITDRRSAELDKMGLM
PLVHRKNSDMAAFISAQSLNKPDEYDDPDATANAALGARLPYMFACCRFAHYLKCIVRDKIGSFSDREQM
QSWLTRWVTQYIDGDPSNSSEETKARKPLAAAEVVVEEVEGAPGYYSSKFFLKPHYQLEGLTVSLRLVSR
LPSAAKA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4648917-4647424 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGTCCGCGACCGAAGCCGCACTGGCCACCAGTAGCACCGAAACAACCGAACAGGGCGACTTTGCCGCGC
TGCTCAATCGCGAGTTCCGTCCCAAGAGCGAGCGCGCCAAGGAAGAAGTGGAATCGGCCGTGCGCACGCT
GGCCGAGCAGGTGCTCAACCGCAGCGATGTGGTCAGCGAAGACGTGTCGCAGACCATCAAGGCCTATATC
GCCGAGATCGATCGTGCCCTCACCGAGCAGCTCAACCAGATCCTGCATCACGCCGATCTGCAGCAGCTCG
AAGGCGCCTGGCGCGGCCTGCATTACCTGGTCAACAACACCGAGACCGACCAGCAGCTCAAGATCCGCGT
GCTGAACATCAGCAAGAAGGAACTGGGCAAGGTGCTCAAGCGCTACAAGGGCACCGCCTGGGACCAGAGC
CCCATCTTCAAGAAGGTCTACGAGCAGGAATACGGCCAGCTCGGTGGCGAACCGTATGGCTGCCTGGTCG
GCGATTACTATTTCGACCAGAGCCCGCCGGATGTGGAACTGCTCAACGGCATGGCGCAGGTGGCTGCTGC
CGCGCATGCACCGTTCATTGCCGCGGCCGCGCCCAAGTTGATGGGCATGGACAACTGGAGCGAGCTCTCC
AACCCGCGCGACCTGGCGAAGATTTTCTCCACGCCCGATTACGCCGCATGGCGCTCGCTGCGCGAATCGG
AAGATTCCAAGTACATCGGCCTGGCCATGCCGCGCACGCTGTCGCGTCTGCCTTACGGCGCGGCCACCAG
CACGGTGGATGAATTCGATTTCGAAGAAGACACTGCCGGCGCTGACTCGTCCAAGTACACCTGGCAGAAC
GCTGCCTATGCGATGGCAGTGAACATCAATCGCTCGTTCAAGCAGTACGGCTGGTGCTCGCGCATTCGCG
GTATCGAATCCGGCGGCGCAGTGGAAGGCTTGCCCACCCACACCTTTCCCACCGACGACGGTGGCGTGGA
CATGAAGTGCCCGACCGAAGTGGCGATCACCGACCGCCGCTCTGCCGAATTGGACAAGATGGGTCTGATG
CCGCTGGTGCATCGCAAGAACTCGGACATGGCCGCCTTCATCAGCGCGCAGTCGCTCAACAAGCCCGACG
AATACGACGACCCGGATGCCACCGCCAACGCAGCGTTGGGCGCGCGCCTGCCCTACATGTTCGCGTGCTG
CCGCTTTGCGCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCTCCGATCGCGAACAGATG
CAGAGCTGGCTGACGCGTTGGGTCACCCAGTACATCGACGGCGACCCGTCCAACTCAAGCGAAGAAACCA
AGGCGCGCAAGCCGCTGGCTGCCGCCGAGGTGGTGGTGGAAGAAGTGGAAGGCGCGCCGGGCTACTACAG
CTCCAAGTTCTTCCTCAAGCCGCATTACCAGCTGGAGGGCCTGACCGTGTCGTTGCGGTTGGTCTCGCGC
CTTCCCTCGGCCGCCAAGGCCTGA