SecReT6
Protein ID: 346726880
SecReT6 ID461
T6SS typei3
Gene symbol-
Locus tagXACM_4015
StrainXanthomonas axonopodis pv. citrumelo F1
Repliconchromosome [GenBank: NC_016010] [Browse all T6SS(s) in this replicon]
Location [Strand]4648922..4649431 [-]
Producthypothetical protein
NoteTssB
UniProt IDG2LYP8
KEGG IDxax:XACM_4015
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-59, Aligned region: 8..161
Protein Sequence: 169 a.a.     [Download]
>gi|346726880|ref|YP_004853549.1| hypothetical protein XACM_4015 [Xanthomonas axonopodis pv. citrumelo F1]
MASSQKFIARNRAPRVQIEYDVEVYGAQKKVQIPFVMGVMSDLSGANAGELPSLDERKALEIDVDNFDSR
LQSMRPRAQFKVPNTLTGEGELAVDITFESMDDFSPAAIARKVAPLAKLLEARTQLANLDTYMDGKAGAE
QLIANAIRDPALLQSLVSAAKPASEPEGA
 
Nucleotide Sequence: 510 bp     [Download]
>gi|346722940|ref|NC_016010.1|:c4649431-4648922 Xanthomonas axonopodis pv. citrumelo F1 chromosome, complete genome
ATGGCCAGCAGTCAGAAGTTCATTGCCCGCAATCGGGCGCCACGGGTGCAGATCGAATACGACGTGGAGG
TCTACGGCGCGCAGAAGAAGGTGCAGATTCCGTTCGTGATGGGGGTGATGTCCGATCTGTCCGGCGCCAA
TGCCGGTGAGCTGCCCTCGCTGGATGAGCGCAAGGCACTGGAGATCGACGTCGACAACTTCGACAGCCGC
CTGCAGTCGATGCGGCCGCGCGCGCAATTCAAGGTGCCCAACACGCTCACCGGCGAAGGCGAGCTGGCGG
TGGATATCACCTTCGAAAGCATGGACGATTTTTCGCCGGCCGCCATCGCGCGCAAGGTTGCGCCGCTGGC
CAAGCTGCTGGAAGCGCGCACGCAGCTGGCCAACCTGGACACCTACATGGACGGCAAGGCCGGTGCAGAG
CAGCTGATTGCCAACGCCATCCGCGACCCGGCGTTGCTGCAGTCGCTGGTGTCGGCCGCCAAGCCTGCCT
CCGAACCGGAAGGAGCCTGA