SecReT6
Protein ID: 347537579
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2778
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3248251..3249618 [-]
Producthypothetical protein
NoteTssC
UniProt IDG2Z537
KEGG IDfbr:FBFL15_2778
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-13, Aligned region: 117..431
Phage_sheath_1 [PF04984], Evalue: 0.0012, Aligned region: 305..433
Protein Sequence: 455 a.a.     [Download]
>gi|347537579|ref|YP_004845004.1| hypothetical protein FBFL15_2778 [Flavobacterium branchiophilum FL-15]
MATPNKEQKTQEVIENQLIDNPIISNTHLLDEYGGFAFLENVIDGLSNMSPNRKARKNIFLNDLQWEGER
NNLLNKLDLWITLLKNSDSIESMIASANKKAELAKKTLNTNLKYALETTKELETSYRSVALFYKNTESDK
IKNVTIVNADLSQLKDLDNTLFFDYISNELKQNFDRLDLRKNYSILSIPGYLGSNAILDKWSKIAHENKA
VLLTDFQDLETPDDVIDIFFNANHTGGDVYKSNTIMTCNYLLGRNRVDEVEEDEHLYVPPSTALAGKLYK
TLMSQVVAGKKFGGLNEVESVRFDLKKSEISELEKMGLVPMVNEYSKIMAFSAKTLFNGDNLGLQTYSVV
RVFDHITKVLFDFLNRRAFENWTTRTEADLRSQIIKFLDGIKGPTNLIEKFTVMKIEQDKTQKDRILLDI
HITPYFPAKSFVIQLDGHKGDGPEDAVWHSDYKQV
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|347534971|ref|NC_016001.1|:c3249618-3248251 Flavobacterium branchiophilum FL-15, complete genome
ATGGCAACTCCAAACAAAGAACAAAAAACACAAGAAGTAATTGAAAATCAATTGATTGACAACCCAATTA
TTAGCAACACTCACTTATTAGATGAATATGGTGGATTTGCATTTTTAGAAAATGTAATCGACGGATTATC
CAACATGAGCCCTAACAGAAAAGCTAGAAAAAACATTTTTTTGAATGATCTACAATGGGAAGGCGAACGA
AACAATTTGCTAAACAAACTGGATTTGTGGATCACTTTATTAAAAAATAGTGATTCTATAGAATCGATGA
TTGCATCGGCCAATAAAAAAGCCGAATTAGCCAAAAAAACATTGAATACCAACCTAAAGTATGCCTTAGA
AACCACAAAAGAATTAGAAACGTCTTATAGAAGTGTGGCACTTTTTTATAAAAATACCGAAAGCGATAAA
ATTAAAAATGTAACTATTGTAAATGCAGATCTTTCCCAATTGAAAGACTTAGACAATACCTTGTTTTTTG
ATTATATATCGAATGAATTGAAGCAAAATTTTGACCGATTGGATTTAAGAAAAAACTATTCTATTCTTTC
AATTCCAGGATATTTGGGTTCCAATGCTATTTTGGATAAATGGTCGAAAATTGCCCATGAAAACAAAGCC
GTATTATTAACCGATTTTCAAGATTTGGAAACTCCAGATGATGTAATTGACATTTTCTTTAACGCCAATC
ATACGGGTGGCGATGTTTATAAATCCAATACGATTATGACTTGTAACTATTTATTAGGTAGAAACCGAGT
AGATGAAGTGGAAGAAGATGAACATTTATATGTACCGCCCTCTACAGCTTTGGCTGGAAAATTATACAAA
ACTTTGATGTCGCAAGTGGTAGCTGGTAAAAAATTTGGAGGATTAAACGAAGTAGAAAGCGTGCGTTTTG
ATCTTAAAAAGAGTGAAATTTCCGAATTAGAAAAAATGGGACTGGTGCCAATGGTGAATGAGTATAGCAA
AATCATGGCATTCTCTGCAAAAACATTATTCAATGGAGATAATTTAGGATTGCAAACCTATTCTGTGGTA
AGAGTCTTTGATCATATTACAAAAGTATTATTCGATTTCTTAAACCGTAGAGCTTTTGAAAACTGGACCA
CCAGAACCGAAGCCGATTTGAGAAGTCAGATTATTAAATTTTTAGATGGCATTAAAGGCCCAACTAATTT
GATAGAAAAATTCACAGTGATGAAAATAGAACAAGATAAAACTCAAAAAGATAGAATTTTACTTGATATT
CATATCACTCCTTATTTTCCAGCAAAAAGTTTTGTAATTCAATTAGACGGTCACAAAGGTGATGGCCCCG
AAGACGCCGTTTGGCATAGCGATTATAAGCAAGTTTAA