SecReT6
Protein ID: 347537580
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2779
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3249621..3250088 [-]
Producthypothetical protein
NoteTssB
UniProt IDG2Z538, G2Z538
KEGG IDfbr:FBFL15_2779
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 0.00046, Aligned region: 48..129
Protein Sequence: 155 a.a.     [Download]
>gi|347537580|ref|YP_004845005.1| hypothetical protein FBFL15_2779 [Flavobacterium branchiophilum FL-15]
MSMFNYGIGGNEVKVDANEAIADIPSNRTLLVQKLTNEQPVAPEAVYDLKTVEEVFEKFKPNVALEFTKE
DGSNLKESMTFKNLGDFGAKSIKENSPFLSKLSTENEQAYKIVKQLSSNRGLIKAIQDPAVKQAIIEMLE
IAKNEINSSKQKAQN
 
Nucleotide Sequence: 468 bp     [Download]
>gi|347534971|ref|NC_016001.1|:c3250088-3249621 Flavobacterium branchiophilum FL-15, complete genome
ATGAGTATGTTTAATTATGGGATTGGAGGAAACGAAGTAAAAGTGGATGCAAACGAAGCTATTGCTGACA
TTCCATCAAATAGAACCCTACTTGTTCAAAAGCTTACAAACGAACAGCCTGTTGCTCCAGAAGCAGTTTA
TGATTTGAAAACAGTTGAAGAAGTTTTTGAAAAATTTAAACCCAATGTAGCACTCGAATTTACTAAAGAA
GATGGTTCAAATTTAAAAGAATCGATGACCTTTAAAAATTTAGGCGATTTTGGAGCCAAATCAATCAAAG
AAAACAGCCCGTTTTTGAGCAAATTAAGTACCGAAAATGAGCAAGCCTATAAAATTGTAAAACAATTATC
GAGCAATAGAGGTTTAATCAAAGCCATTCAAGATCCTGCGGTAAAGCAAGCGATTATTGAAATGCTCGAA
ATTGCAAAAAATGAAATCAATTCGTCCAAACAAAAAGCACAAAATTAA