SecReT6
Protein ID: 347537581
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2780
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3250238..3250657 [+]
Productputative bacteriophage Gp25 protein
NoteTssE
UniProt IDG2Z539
KEGG IDfbr:FBFL15_2780
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.80E-09, Aligned region: 23..108
Protein Sequence: 139 a.a.     [Download]
>gi|347537581|ref|YP_004845006.1| putative bacteriophage Gp25 protein [Flavobacterium branchiophilum FL-15]
MKYIKYPISFDSLLKGVNKIQCEIQESIAYNIMLIVTTSFGEIPEMPNFGSIIWDLEFDQHINRRTWEET
VKNSLFDSISKNEHRLNLTSVVITLDEVEDNELKNSIRRKANIIVKGIIKNSLIPFNFHTKLNISPISQ
 
Nucleotide Sequence: 420 bp     [Download]
>gi|347534971|ref|NC_016001.1|:3250238-3250657 Flavobacterium branchiophilum FL-15, complete genome
ATGAAATATATAAAATACCCTATATCATTCGACTCTTTATTGAAAGGGGTAAATAAAATTCAATGTGAAA
TTCAGGAGTCTATCGCTTACAATATTATGTTAATTGTAACCACATCATTTGGCGAAATTCCAGAGATGCC
CAATTTTGGATCCATTATTTGGGATTTAGAGTTTGATCAACACATCAATAGAAGAACATGGGAAGAAACG
GTGAAAAACTCATTGTTTGATTCTATTTCAAAAAACGAACACCGTTTAAATCTTACAAGTGTGGTAATCA
CTTTGGATGAAGTAGAAGATAATGAATTGAAAAACAGTATTAGAAGAAAAGCCAATATAATAGTAAAAGG
AATCATCAAAAATAGTTTGATTCCTTTTAATTTTCATACAAAATTAAATATCAGTCCCATTTCGCAATAA