SecReT6
Protein ID: 347537582
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2781
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3250669..3252423 [+]
Producthypothetical protein
NoteTssF
UniProt IDG2Z0A5
KEGG IDfbr:FBFL15_2781
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 584 a.a.     [Download]
>gi|347537582|ref|YP_004845007.1| hypothetical protein FBFL15_2781 [Flavobacterium branchiophilum FL-15]
MKDKKFIQIKNRIHKQCLELWGIDDLEMADPLIMMLLDVIIYEVYYLNQEVIDSDAKIIERVAQQVTPNS
WSLPMPAHALVSTITNNGITIINEETEFSVKNNLNHNTSTAIYFTPFTEEKIIEGSVKFQYYDNYLLYNN
AVEVLKNKISDYKVWIGIDCAEAILTDLETLKITFLTNNSSLDHLLKLVEIRDVNGTIVEKTNENFSEVA
DNKHYTESIKTHYSNYIYKLILQPENLVYKNILEQFSIQKEDIKCGEAQLKVVWLELTFPEVFTKEELDK
ITIAINTFPAINRKQNQITHHLSKDGRLFSMKGTSESHFLDVHTITDEKNNAFIDSIKFPIDATQNNTYT
LFHGGLENYDPRNAKFFLKKLARVLREDVSAFSSINADYIDSTMARISEEINAIELKINISFSDINNKDD
VFALINTTEKVNTLYCSYWTSEGELANGFKKGTILKQAVVSELVSEKTILQTTSMGGIFRTDKAEKLINM
RYGFLTKERLVTTQDIKAAIQFYLRNTTKEITIKDGVGISSTKKKGLFRTIDVAITLENENQLETNSKQK
MERFLKETLEEQSVMNIPYQITIN
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|347534971|ref|NC_016001.1|:3250669-3252423 Flavobacterium branchiophilum FL-15, complete genome
ATGAAAGACAAAAAATTTATCCAAATAAAAAACAGAATTCACAAACAGTGTTTAGAATTATGGGGAATTG
ACGATTTAGAAATGGCCGATCCATTGATTATGATGTTGCTGGATGTCATTATTTATGAAGTATATTACCT
CAATCAAGAAGTTATTGATTCCGATGCTAAAATTATTGAGCGTGTTGCTCAGCAAGTAACGCCAAATAGC
TGGAGTTTGCCTATGCCAGCCCATGCCCTTGTGAGTACTATTACGAATAACGGCATTACTATTATTAATG
AAGAAACCGAATTTTCTGTTAAAAATAATTTGAATCACAATACTAGTACTGCCATTTATTTTACGCCTTT
TACAGAAGAAAAAATTATTGAAGGTTCGGTTAAATTTCAGTATTACGACAATTATTTGTTGTATAATAAT
GCTGTTGAAGTTTTAAAAAATAAAATTTCAGACTATAAAGTTTGGATAGGAATTGATTGTGCTGAGGCTA
TTTTAACAGATTTAGAAACGCTGAAAATCACTTTTCTTACCAATAATTCATCGCTCGACCATCTATTAAA
ATTGGTTGAAATTAGAGATGTTAACGGTACTATAGTAGAAAAAACGAACGAAAATTTCAGCGAAGTAGCA
GACAACAAACATTATACAGAAAGTATAAAAACACATTACAGCAATTATATTTATAAGCTAATCTTACAAC
CAGAAAATTTGGTTTATAAAAACATTTTAGAGCAATTTTCCATCCAAAAAGAAGACATCAAATGTGGTGA
AGCCCAACTGAAAGTCGTTTGGCTAGAGCTTACTTTTCCTGAAGTTTTTACCAAAGAAGAATTGGACAAA
ATAACCATTGCCATTAACACTTTTCCAGCCATCAACAGAAAACAAAACCAAATTACCCACCATTTAAGTA
AAGATGGGCGCTTGTTTTCTATGAAAGGCACTAGCGAATCTCACTTTTTAGATGTTCATACTATTACTGA
TGAAAAAAACAATGCTTTTATAGACAGTATAAAATTTCCAATAGATGCCACTCAAAACAATACCTATACC
TTGTTTCATGGCGGATTAGAAAACTATGACCCTCGAAATGCTAAATTCTTCCTTAAAAAATTAGCCCGAG
TGTTACGAGAAGATGTCAGTGCTTTTTCGAGTATCAATGCCGATTATATAGACTCAACCATGGCACGAAT
TAGCGAAGAAATAAACGCTATTGAACTTAAAATTAACATCAGCTTTAGTGATATTAACAACAAAGACGAT
GTGTTTGCACTAATCAATACTACCGAAAAAGTAAATACGTTATACTGTTCCTACTGGACATCGGAAGGCG
AACTGGCCAATGGTTTTAAAAAAGGCACCATTTTAAAACAAGCTGTTGTGTCCGAATTAGTGTCTGAAAA
AACCATTCTTCAAACCACTTCAATGGGTGGCATATTCCGAACTGATAAAGCCGAAAAACTCATCAATATG
CGGTATGGTTTTTTAACCAAAGAACGTCTTGTTACCACTCAAGACATCAAAGCAGCCATACAATTTTATT
TGAGAAACACCACCAAAGAAATCACTATTAAAGACGGGGTGGGAATAAGCTCAACCAAGAAAAAAGGACT
TTTTAGAACCATTGATGTTGCCATAACCTTAGAAAACGAAAACCAACTGGAAACCAACAGCAAACAAAAA
ATGGAACGCTTTCTAAAAGAAACATTGGAAGAACAATCGGTTATGAATATTCCTTATCAAATTACAATCA
ACTAA