SecReT6
Protein ID: 347537598
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2799
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3266841..3267740 [+]
Producthypothetical protein
NoteTssN
UniProt IDG2Z5I8
KEGG IDfbr:FBFL15_2799
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 299 a.a.     [Download]
>gi|347537598|ref|YP_004845023.1| hypothetical protein FBFL15_2799 [Flavobacterium branchiophilum FL-15]
MTTLLPFFLKYLLAPFLILIISFIMGQFSAIKVKIKSAIIFVLCFSILIAITSLFAFFNNEFIWFGLLFS
ILYYILLGIGLLYYMNTNFFKGIGIMESLLGKFFIFLIVTILSCWIYYLVFNLIAISSYVHYIMFTILWV
FVPFLFSELKQKYVAIPYPFYQSWKVGTGRTDNEYWDNIDKFHLMQVSIKIKKRSDSEFFSKFDVKIAQE
VNLGSWFDKFIEDQNYRFPNDAIETNATDENMGWIFYTPKYFKFPLFIRNLDPTKPIAESNIKNKQVIFA
KRVSLNNEDDTKLGENDDV
 
Nucleotide Sequence: 900 bp     [Download]
>gi|347534971|ref|NC_016001.1|:3266841-3267740 Flavobacterium branchiophilum FL-15, complete genome
ATGACCACACTACTTCCATTTTTTTTAAAGTACCTTTTGGCACCTTTTTTAATTCTGATAATTTCTTTTA
TTATGGGGCAATTTTCAGCCATAAAAGTAAAGATTAAATCAGCCATTATCTTTGTGCTTTGTTTTTCAAT
TTTAATAGCCATTACCAGTTTATTTGCTTTTTTCAACAACGAATTTATTTGGTTTGGATTACTATTTTCC
ATTCTTTATTATATTCTTTTAGGCATTGGATTGTTATATTACATGAATACCAATTTTTTTAAAGGCATAG
GAATTATGGAATCATTGCTTGGTAAATTTTTCATTTTCCTAATAGTAACCATTTTATCTTGTTGGATCTA
CTATTTAGTATTCAATTTAATCGCTATTTCTAGTTATGTTCATTATATTATGTTTACTATTTTATGGGTT
TTTGTCCCGTTTTTGTTTTCAGAACTAAAGCAAAAATACGTAGCCATTCCATACCCGTTTTACCAATCTT
GGAAAGTTGGAACTGGACGTACAGACAATGAATATTGGGACAACATAGACAAGTTTCATTTGATGCAAGT
TTCCATAAAAATCAAAAAAAGAAGCGACTCAGAATTTTTCTCAAAATTTGATGTAAAAATAGCACAAGAA
GTAAATCTGGGCAGTTGGTTTGATAAATTTATTGAAGATCAAAACTATCGTTTTCCAAATGACGCCATCG
AAACCAATGCAACCGATGAAAACATGGGCTGGATATTTTACACCCCAAAATACTTTAAATTTCCACTGTT
CATAAGAAATTTAGACCCCACAAAACCTATTGCCGAAAGTAACATAAAAAATAAACAAGTGATTTTTGCT
AAACGGGTTTCGTTGAATAATGAAGATGATACAAAATTGGGGGAGAATGACGATGTTTAA