SecReT6
Protein ID: 347537601
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2802
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3269478..3270611 [+]
Producthypothetical protein
NoteTssK
UniProt IDG2Z5J1
KEGG IDfbr:FBFL15_2802
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 377 a.a.     [Download]
>gi|347537601|ref|YP_004845026.1| hypothetical protein FBFL15_2802 [Flavobacterium branchiophilum FL-15]
MKNTYLPINWTDGVKLTKDHFINNYFNFVATVNDYTNVRLNNYNYGIVDEATDTSFEMETKANNANLEVS
LKKCHCIAKNGHLIVFNADIYGEDFPQASLFGSSLDPNANDTFYVIVSVNPFNLIPVGVPDPEVVPLHHP
NAAPEIKLHIINKNEVNPNFLEGYFLILKKYNFKNGVFDEDTKYIPSVSKLKNNKLLIDFNKNATMELEQ
IYDFSIKIHKKNIHNSMNNKLVLNTFSLCEKIIGFYTDAIFFLRNRALEEPPIFMLEKMVILSNSLMATL
ALMDEKEKEMLLQYYYEWVDIKPSELLQVISQTNGATYDHNDIYVTLQKTDQFIGIIKKLWKKLSELEYI
GVRKENIVISEETKTAAPKSRTWSILD
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|347534971|ref|NC_016001.1|:3269478-3270611 Flavobacterium branchiophilum FL-15, complete genome
ATGAAAAACACATACTTACCCATTAATTGGACAGACGGAGTAAAGCTCACAAAAGACCATTTTATCAACA
ACTATTTCAATTTTGTAGCAACCGTTAATGATTATACAAATGTAAGGTTGAATAATTACAACTACGGAAT
AGTTGATGAAGCCACGGATACATCTTTTGAAATGGAAACAAAAGCCAATAATGCTAACTTGGAAGTTTCC
TTAAAAAAGTGTCATTGTATTGCCAAAAACGGACACTTAATTGTTTTTAATGCCGACATTTATGGCGAAG
ACTTTCCGCAAGCCTCTTTGTTTGGGTCTAGTTTAGACCCCAATGCAAACGATACGTTTTATGTAATTGT
ATCGGTAAATCCTTTTAACTTAATTCCTGTTGGTGTTCCGGACCCCGAGGTGGTACCACTTCATCATCCA
AATGCTGCACCTGAAATAAAACTGCACATCATCAATAAAAACGAGGTAAATCCTAATTTTTTGGAAGGCT
ATTTTTTAATTCTAAAAAAATATAACTTTAAAAACGGTGTGTTTGATGAAGATACAAAATACATCCCATC
TGTTTCAAAACTCAAAAACAACAAACTGTTGATTGATTTTAATAAAAATGCCACCATGGAATTGGAACAA
ATTTATGACTTTTCCATAAAAATCCATAAAAAGAACATTCATAATTCAATGAACAATAAATTGGTATTAA
ACACCTTTAGTCTTTGCGAAAAAATTATTGGTTTTTATACCGATGCTATTTTCTTTTTAAGAAATAGGGC
TTTAGAAGAACCGCCCATTTTTATGCTGGAAAAAATGGTGATACTTTCTAATAGTTTAATGGCAACATTA
GCATTAATGGACGAAAAAGAAAAAGAAATGTTGTTGCAATATTATTATGAATGGGTAGATATAAAACCAT
CGGAATTATTACAGGTAATTTCTCAAACTAATGGAGCAACTTATGACCATAACGACATTTATGTAACCTT
GCAAAAAACAGATCAATTTATTGGAATAATAAAAAAACTATGGAAAAAACTAAGCGAATTAGAATACATA
GGCGTTAGAAAAGAAAACATTGTAATTAGCGAAGAAACAAAAACCGCAGCTCCAAAAAGTAGAACTTGGT
CAATTTTAGATTAA