SecReT6
Protein ID: 347537602
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2803
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3270619..3271527 [+]
Producthypothetical protein
NoteHcp
UniProt IDG2Z5J2
KEGG IDfbr:FBFL15_2803
PDB IDNA
Domain hit(s) vs Pfam Toxin_44 [PF15523], Evalue: 2.50E-25, Aligned region: 162..245
Protein Sequence: 302 a.a.     [Download]
>gi|347537602|ref|YP_004845027.1| hypothetical protein FBFL15_2803 [Flavobacterium branchiophilum FL-15]
MISAKLYILGEERELLWISTNYFKGTRADGSLTSEVNGGLLTLSFVTQESDGLFLENMTKKVKNETDRME
KGKIHFFENGFNDVPAKKYKFEDAYIIQFSEIFTTYETGRMETILTISPAIQDYGKQVIKPWQISWLPPS
ETAFYQTAKATEIKEEKIVDENPCDCTTAEKDKLQREVTNKCKGGIMKKCTDTDNCGSLISKEAQFRECM
NARIKINTKCFKGGDAGHKLQVQQAINGMINCQNLAILKCKPKEPTKLPVIDESLKEKISRLTGLTGTAL
IIYIILSEGSRLFPPRNLVPIP
 
Nucleotide Sequence: 909 bp     [Download]
>gi|347534971|ref|NC_016001.1|:3270619-3271527 Flavobacterium branchiophilum FL-15, complete genome
ATGATTTCTGCGAAACTATATATTTTAGGAGAAGAACGAGAATTACTTTGGATTAGCACAAATTATTTCA
AAGGTACGAGAGCAGATGGTTCACTAACAAGCGAAGTAAATGGAGGGTTGTTGACATTATCTTTTGTTAC
TCAAGAAAGCGATGGGTTGTTTTTGGAAAATATGACAAAAAAAGTTAAAAATGAAACAGATAGAATGGAA
AAAGGCAAAATACATTTTTTTGAGAATGGATTCAATGATGTACCAGCCAAAAAATACAAATTTGAAGATG
CCTATATAATTCAATTTTCTGAAATATTTACTACTTATGAAACAGGAAGAATGGAAACTATATTAACAAT
TTCTCCTGCAATTCAAGATTATGGTAAACAAGTTATAAAACCTTGGCAAATATCTTGGCTTCCACCTAGT
GAAACTGCTTTTTATCAAACGGCAAAGGCTACTGAAATAAAAGAAGAAAAAATAGTTGATGAAAATCCAT
GTGATTGCACAACTGCTGAAAAGGATAAATTGCAAAGAGAGGTAACAAATAAATGCAAGGGTGGAATTAT
GAAAAAATGCACTGATACAGATAATTGCGGCTCTTTAATTTCTAAAGAAGCCCAATTTAGAGAGTGCATG
AATGCTCGGATAAAGATTAATACAAAATGTTTTAAAGGAGGTGATGCAGGACATAAATTACAAGTACAAC
AAGCAATAAACGGAATGATCAATTGCCAAAATTTAGCGATATTAAAATGTAAACCCAAAGAACCAACAAA
ACTTCCTGTAATTGACGAGAGTTTAAAAGAAAAAATTTCTAGATTAACAGGATTAACAGGAACAGCACTT
ATTATCTATATAATTTTATCTGAAGGAAGTAGGTTGTTTCCTCCAAGAAATTTAGTACCAATTCCATAA