SecReT6
Protein ID: 347537606
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2807
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3273120..3274055 [+]
Producthypothetical protein
NoteTssP
UniProt IDG2Z5J6
KEGG IDfbr:FBFL15_2807
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 4.30E-12, Aligned region: 51..103
PKD [PF00801], Evalue: 4.30E-12, Aligned region: 133..183
Y_Y_Y [PF07495], Evalue: 0.0029, Aligned region: 64..103
Y_Y_Y [PF07495], Evalue: 0.0029, Aligned region: 161..186
Protein Sequence: 311 a.a.     [Download]
>gi|347537606|ref|YP_004845031.1| hypothetical protein FBFL15_2807 [Flavobacterium branchiophilum FL-15]
MNINNKTKAYILISIVAILLLIALLFPFNKKLNNLDYLILDSNNNHLFENNEKLQFKINDSTLLEGKKAV
WYFGNGDSIVSNKSVTYSFTRNGKYLITFRVDDKFDFSKQINIVNNKYFSAYDSIPKVFCEDFAYVGEEV
VFSSYAPGSTKWYWEFGETGTIDSYEKQAIYKFTKPGTYTVQLETDKTKYPITRDIEIYPLYEAFKEPEK
IDSTSIITNDIKKRLQIIAGLSVNNQAGFNTQVNYLKKKYFCHDLSKIVVIVNEEKYNDFLSYCQGLHYL
GGKSTLISDVKIDTVKCFKEIKVTQTLKKAK
 
Nucleotide Sequence: 936 bp     [Download]
>gi|347534971|ref|NC_016001.1|:3273120-3274055 Flavobacterium branchiophilum FL-15, complete genome
ATGAACATTAACAATAAAACAAAAGCCTATATTTTAATTAGTATTGTTGCAATATTACTACTTATCGCCT
TGCTATTTCCGTTCAATAAAAAGCTGAATAATTTGGACTATTTAATTTTAGACTCCAACAACAATCACTT
GTTTGAAAACAACGAAAAATTGCAATTTAAAATTAACGATTCTACTTTATTAGAAGGAAAAAAAGCAGTT
TGGTATTTTGGAAACGGCGATTCAATCGTGAGCAATAAATCGGTAACTTATAGCTTTACCCGAAACGGTA
AATATTTGATTACGTTTCGTGTAGATGATAAATTTGATTTCTCCAAACAAATTAACATTGTCAACAACAA
GTATTTTTCTGCTTACGACTCTATCCCAAAAGTGTTTTGCGAAGATTTTGCTTATGTAGGCGAAGAAGTT
GTTTTTTCGAGTTATGCTCCAGGTTCCACAAAATGGTATTGGGAATTTGGCGAAACAGGAACTATAGATT
CTTATGAAAAACAAGCCATTTATAAATTTACAAAACCTGGCACTTATACGGTGCAATTAGAAACCGATAA
AACAAAATATCCCATTACAAGAGATATTGAAATTTATCCATTGTACGAAGCATTTAAAGAACCCGAAAAA
ATAGATTCAACCAGTATCATTACCAACGACATTAAAAAAAGACTACAAATTATTGCAGGGTTGAGTGTCA
ATAATCAGGCAGGTTTTAACACACAAGTCAATTATTTGAAAAAGAAATATTTTTGTCACGACCTTTCAAA
AATTGTGGTGATAGTCAATGAAGAAAAATACAACGATTTTTTAAGCTATTGCCAAGGATTACACTATTTA
GGAGGAAAATCGACCCTAATAAGCGATGTAAAAATAGATACTGTAAAGTGTTTCAAAGAGATAAAAGTAA
CACAAACATTGAAAAAAGCGAAGTAA