SecReT6
Protein ID: 347537621
SecReT6 ID921
T6SS typeiii
Gene symbol-
Locus tagFBFL15_2831
StrainFlavobacterium branchiophilum FL-15
Repliconchromosome [GenBank: NC_016001] [Browse all T6SS(s) in this replicon]
Location [Strand]3294510..3294905 [+]
Producthypothetical protein
NoteHcp
UniProt IDG2Z5M6
KEGG IDfbr:FBFL15_2831, fbr:FBFL15_2854
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 131 a.a.     [Download]
>gi|347537621|ref|YP_004845046.1| hypothetical protein FBFL15_2831 [Flavobacterium branchiophilum FL-15]
MAFKALLEIEGNEYQVLFSKVDMTRHVDGKGAVSSEVKGGRVNVKVKSTDNTTIIEQAVNSQHKPVSGKI
KYFKADSEQVMKELAFENAFIVFFSEVLDALAETPMTTEITFSAEKITLGNATLDNNWAKV
 
Nucleotide Sequence: 396 bp     [Download]
>gi|347534971|ref|NC_016001.1|:3294510-3294905 Flavobacterium branchiophilum FL-15, complete genome
ATGGCATTCAAAGCACTATTAGAAATCGAAGGAAACGAGTATCAAGTATTATTCTCAAAAGTAGATATGA
CCCGCCACGTGGACGGAAAAGGCGCTGTTTCCTCTGAAGTAAAAGGCGGTAGAGTTAATGTAAAAGTAAA
GTCAACAGACAATACTACTATTATTGAACAAGCAGTAAACAGCCAACACAAACCTGTTTCAGGAAAAATT
AAATACTTCAAAGCAGATTCTGAACAAGTAATGAAAGAATTGGCTTTTGAAAACGCATTTATCGTGTTTT
TCAGCGAAGTATTAGATGCCTTGGCAGAAACGCCAATGACTACCGAAATTACTTTCTCAGCAGAAAAAAT
TACTTTAGGTAACGCTACTTTAGACAACAACTGGGCTAAAGTATAG