SecReT6
Protein ID: 356875268
SecReT6 ID787
T6SS typei1
Gene symbolevfA
Locus tagEvfA
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]471..950 [-]
ProductEvfA
NoteTssD
UniProt IDG8IRK9, G8IRK9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.90E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|356875268|ref|AET37190.1| EvfA [Escherichia coli RS218]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITKPVDKSSP
LLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHTINDSPGQAEESVSFTYESIN
WEHSVAGTSAYSLWSERIF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|356875267|gb|JN837480|evfA|:471-950
ATGGCAAATCCCGTCTATCTGACACTGAACGGAGAACTTCAGGGGCTGATTTCATCCGGATGCTCGTCAA
TGCCGTCCATCGGTAACAAAGCCCAGATTGCACATCAGGATCAGATCATGGTGACGTCACTGTCCCATGG
TCTGAGCCGTGCGCAGAATGTCAACCATCAGGAGTTGACCATCACGAAACCGGTGGACAAATCCTCCCCT
CTGCTGGGCAAGGCCATTTCAGAGAATGAATGTCTGACCTGTGATTTTGTATTCTACCGCACCAACCGCT
TTGGAATTAATGAACCGTACTACAAGCTGAAACTGGCTAACGCCCGGCTCTCAAACATCGGCCTTACCGT
TCCCCATACCATTAACGACAGTCCAGGGCAGGCGGAAGAGTCTGTGTCATTTACCTATGAGAGCATCAAT
TGGGAGCACAGCGTCGCCGGAACCAGTGCATACAGCCTTTGGAGTGAACGGATTTTCTAA