SecReT6
Protein ID: 356875271
SecReT6 ID787
T6SS typei1
Gene symbolevfE
Locus tagEvfE
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]5885..6316 [-]
ProductEvfE
NoteTssA
UniProt IDG8IRL4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 143 a.a.     [Download]
>gi|356875271|ref|AET37193.1| EvfE [Escherichia coli RS218]
MADAIRDEVTDFLARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDENGL
EAALRYLENLPEGDPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLT
AEQ
 
Nucleotide Sequence: 432 bp     [Download]
>gi|356875267|gb|JN837480|evfE|:5885-6316
GTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTGGCCCGCCTGCCCGCACTGATCAACCTGTTGT
TTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAACAGTGGCTGGCATCATCCGGCTCAGTCAACCA
GACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGCGGCCAAGGCGTGCTTCGATGAAAACGGGCTG
GAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGTGATCCCCGCCACCAGTTTCACCGCCAGTTTT
TCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGCTTGCACAACAGCAGTACCGGATGCTCTTCAG
AACAGGATTACACATGATGCTATCCGAATGGGAGCCTTCCCTGCTGAAAGCACTGGAACAAAAACTCACG
GCAGAACAGTAA