SecReT6
Protein ID: 356875275
SecReT6 ID787
T6SS typei1
Gene symbolevfH
Locus tagEvfH
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]8072..9130 [-]
ProductEvfH
NoteTssH
UniProt IDG8IRL6, G8IRL6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.10E-39, Aligned region: 72..233
AAA_5 [PF07728], Evalue: 2.60E-12, Aligned region: 77..198
ClpB_D2-small [PF10431], Evalue: 5.80E-12, Aligned region: 239..315
AAA [PF00004], Evalue: 3.80E-08, Aligned region: 78..195
AAA_16 [PF13191], Evalue: 4.40E-05, Aligned region: 48..118
AAA_16 [PF13191], Evalue: 4.40E-05, Aligned region: 143..171
AAA_16 [PF13191], Evalue: 4.40E-05, Aligned region: 281..306
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 72..106
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 139..160
AAA_25 [PF13481], Evalue: 0.00098, Aligned region: 204..269
AAA_22 [PF13401], Evalue: 0.0063, Aligned region: 76..166
AAA_19 [PF13245], Evalue: 0.0085, Aligned region: 69..99
Protein Sequence: 352 a.a.     [Download]
>gi|356875275|ref|AET37197.1| EvfH [Escherichia coli RS218]
MLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPVWLGGTIKGQDLAIASLHKHLLTARADLRRP
GRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTE
AIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPET
MQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGADVIIGPEVTDEIMSR
VTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAADGAFTADVEDALPDDAVTPQTEDET
VL
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|356875267|gb|JN837480|evfH|:8072-9130
TTGCTGGTTTCCCCGCATGTCGATAAAAAACAGATTGCAGCGGTGATTGCTGAATGGACCGGCGTGCCGC
TTAACCGCCTGTCACAGAATGAGATGTCGGTCATCACCGACCTGCCGGTATGGCTCGGCGGCACCATCAA
GGGCCAGGACCTGGCGATTGCCAGCCTGCATAAACACCTGCTGACCGCACGCGCCGACCTGCGCCGTCCG
GGACGCCCGCTTGGTGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGGGTAAAACCGAAACCGTCCTGCAAC
TGGCGGAACTGCTCTATGGCGGACGTCAATACCTGACCACCATCAATATGTCTGAGTTCCAGGAGAAACA
CACCGTTTCGCGGCTGATTGGCTCTCCTCCGGGTTATGTCGGCTACGGTGAAGGCGGCGTACTGACCGAA
GCGATTCGCCAGAAACCGTACTCGGTGGTGCTGCTCGATGAAGTAGAAAAAGCGCACCCGGATGTACTCA
ACCTGTTCTACCAGGCGTTTGACAAGGGCGAGATGGCAGACGGTGAAGGCCGCCTGATTGACTGTAAAAA
TATCGTTTTCTTCCTGACCTCCAACCTTGGCTACCAGGTGATTGTCGAACACGCCGATGACCCGGAAACC
ATGCAGGAAGCCCTCTATCCGGTGCTGGCGGACTTCTTTAAACCTGCTCTGCTGGCGCGCATGGAAGTGG
TGCCTTACCTACCGCTGTCGAAAGAGACGCTCGCTACCATTATTGCCGGGAAACTGGCCCGCCTGGATAA
CGTGCTGCGCAGCCGCTTTGGCGCGGACGTGATTATTGGGCCGGAAGTGACGGACGAAATCATGAGCCGC
GTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTTATCGACGGCGACATGCTGCCGCCGCTCT
CGCTGCTGCTGTTGCAGAAAATGGCGGCCAACACGGCGATTGCCCGGATTCGCCTGTCGGCGGCAGACGG
TGCGTTCACGGCAGATGTGGAAGATGCGCTGCCTGATGATGCCGTGACACCGCAAACAGAGGACGAAACG
GTTTTATGA