SecReT6
Protein ID: 356875276
SecReT6 ID787
T6SS typei1
Gene symbolevfI
Locus tagEvfI
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]9085..9714 [-]
ProductEvfI
NoteTssH
UniProt IDG8IRL7, G8IRL7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 209 a.a.     [Download]
>gi|356875276|ref|AET37198.1| EvfI [Escherichia coli RS218]
MNNLTAVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARVAINLSSPPKQISALTTLSHQQEAEI
RQLERELRIGLRTDTSRMTEVLEQYDETLSALDELEVAWQQQTLVQEIIALRQQLLGVAEDDVASLPDAD
AVEDTPPEAEQDSTDAESADDAGSVQPEETAETVSPGTTAGTTHCRTGLPCITTSCWFPRMSIKNRLQR
 
Nucleotide Sequence: 630 bp     [Download]
>gi|356875267|gb|JN837480|evfI|:9085-9714
ATGAACAATCTCACGGCAGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACACTGAGCGAGCGTT
ATCTCTCCGGGCGTCAGTTGCCGGACAAAGCCATTGATGTGCTGGACACCGCCTGCGCCCGTGTGGCCAT
CAACCTGTCATCGCCGCCAAAACAAATCTCGGCACTGACCACCCTGAGCCACCAGCAGGAGGCAGAAATT
CGCCAGCTTGAGCGCGAGCTTCGCATCGGGCTGCGTACCGACACCTCACGAATGACTGAGGTGTTGGAGC
AGTATGATGAAACGCTGTCGGCGCTGGACGAACTGGAAGTCGCCTGGCAGCAGCAGACGCTGGTACAGGA
AATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAAGACGACGTTGCGTCGTTGCCGGACGCAGAT
GCCGTGGAGGATACGCCGCCAGAGGCAGAACAGGATAGTACCGATGCCGAATCGGCTGATGATGCAGGCA
GCGTACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCTGGTACAACGGCTGGCACAACTCACTGCCGAAC
TGGACTGCCCTGCATAACGACCAGTTGCTGGTTTCCCCGCATGTCGATAAAAAACAGATTGCAGCGGTGA