SecReT6
Protein ID: 356875277
SecReT6 ID787
T6SS typei1
Gene symbolevfJ
Locus tagEvfJ
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]9686..10834 [-]
ProductEvfJ
NoteTssH
UniProt IDG8IRL8, G8IRL8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA [PF00004], Evalue: 1.40E-07, Aligned region: 30..57
AAA [PF00004], Evalue: 1.40E-07, Aligned region: 221..332
AAA_16 [PF13191], Evalue: 0.00066, Aligned region: 131..152
AAA_16 [PF13191], Evalue: 0.00066, Aligned region: 198..237
AAA_16 [PF13191], Evalue: 0.00066, Aligned region: 263..298
AAA_22 [PF13401], Evalue: 0.00069, Aligned region: 219..305
Clp_N [PF02861], Evalue: 0.0018, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.0018, Aligned region: 106..123
Clp_N [PF02861], Evalue: 0.0018, Aligned region: 133..147
NACHT [PF05729], Evalue: 0.006, Aligned region: 220..247
NACHT [PF05729], Evalue: 0.006, Aligned region: 294..343
Protein Sequence: 382 a.a.     [Download]
>gi|356875277|ref|AET37199.1| EvfJ [Escherichia coli RS218]
MIQIDLATLVKRLNPFAKQALEMAASECMSQQASEITVAHVLLQMLAIPRNDVRVIAERTGISAEDLRQA
LTVESYPGGRSAEGYPSFSPMLIEWLKESWLLASAQMQHSELRSGVLLLTLLHSPLRYIPPAAARLLTAI
NRDQLQQDFAAWTKESAESVDLAGGQTPRATETGDTLLARYAKNMTADARNGRLDPVLCRNYEIDLMIDI
LCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLM
AEVIFSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRF
QLVKVSEPNAAEATIILRGLSAVYEQSHGSAD
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|356875267|gb|JN837480|evfJ|:9686-10834
ATGATCCAGATTGATTTAGCCACGCTCGTAAAGCGGCTTAACCCCTTTGCAAAACAGGCGCTGGAAATGG
CTGCCTCGGAGTGTATGAGCCAGCAGGCCAGTGAGATCACCGTTGCCCATGTGCTGTTACAGATGCTGGC
AATCCCGCGCAACGACGTAAGGGTGATTGCCGAACGCACAGGCATCAGTGCGGAGGATTTACGCCAGGCG
CTGACCGTGGAGAGTTATCCCGGTGGACGTTCCGCCGAAGGCTATCCCAGCTTCTCCCCGATGCTGATCG
AATGGCTCAAGGAGTCATGGCTGCTGGCCTCAGCCCAGATGCAGCACAGCGAACTGCGCAGCGGCGTCCT
GCTGCTTACTCTGCTGCATTCACCGCTGCGCTATATTCCACCCGCTGCTGCCCGTCTGCTGACGGCCATA
AACCGCGACCAGTTACAGCAGGATTTCGCAGCATGGACAAAAGAATCCGCCGAATCCGTGGATCTGGCTG
GCGGGCAAACGCCCCGCGCAACGGAAACCGGCGACACCCTGCTTGCCCGCTACGCCAAAAACATGACCGC
AGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCAACTATGAAATCGACCTGATGATCGACATT
CTCTGCCGCCGCCGTAAAAACAATCCGGTGGTAGTGGGCGAAGCAGGCGTGGGTAAAAGCGCGCTGATTG
AAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCATGACCCT
TGACCTGGGCGCATTGCAGGCCGGTGCGTCGGTGAAAGGTGAGTTTGAAAAACGCTTCAAGGGGCTGATG
GCGGAGGTCATTTTCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTGGCGCGG
GCAACCAGCAGGGCGGGCTGGATATATCCAACCTGCTCAAACCAGCGCTGGCGCGCGGCGAGCTGAAAAC
CATCGCCGCCACCACCTGGAGCGAGTACAAAAAATATTTCGAGAAAGATGCAGCTTTGTCGCGCCGCTTC
CAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTTTGTCGGCGGTCT
ATGAACAATCTCACGGCAGTGCTGATTGA