SecReT6
Protein ID: 356875281
SecReT6 ID787
T6SS typei1
Gene symbolevfN
Locus tagEvfN
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]13483..14091 [-]
ProductEvfN
NoteFha
UniProt IDG8IRM2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 202 a.a.     [Download]
>gi|356875281|ref|AET37203.1| EvfN [Escherichia coli RS218]
MNFLPWRSTTWPVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLSLQQQQNSLSDKHLRPLED
NPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVEALRVMLDAFSPGNLMRRF
AQYRRSHELRQKMDDAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRVLREKQREPEA
 
Nucleotide Sequence: 609 bp     [Download]
>gi|356875267|gb|JN837480|evfN|:13483-14091
ATGAATTTTCTGCCATGGCGCAGTACCACCTGGCCTGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGC
TGACGCTGCACAATTCTCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCAT
TAAGGGATTGCTGAGTCTGCAACAACAACAGAACAGCCTGTCGGATAAACACCTGCGTCCACTAGAAGAC
AACCCGTTGCGCCTTGATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGG
TACATCTCGCAGCACCTGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCTAACCG
GGCGGCGATTGTGGAAGCGTTGCGTGTCATGCTGGACGCCTTTTCGCCGGGCAACCTGATGCGCCGCTTT
GCGCAATACCGCCGCAGCCATGAACTGCGCCAGAAAATGGACGACGCCTGGGCATGGCAGATGTACAGCA
ACTATTACGATGAGCTGGCCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCA
GGTCTATGACCGGGTGCTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA