SecReT6
Protein ID: 356875282
SecReT6 ID787
T6SS typei1
Gene symbolevfO
Locus tagEvfO
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]13991..14764 [-]
ProductEvfO
NoteFha
UniProt IDG8IRM3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00052, Aligned region: 40..104
Protein Sequence: 257 a.a.     [Download]
>gi|356875282|ref|AET37204.1| EvfO [Escherichia coli RS218]
MAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIRHDGA
YCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDSLADT
LLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANGINTP
FMDLPPGNARHEDGDEFSAMAQYHLACNPAAARYGVSADAAQFSGCG
 
Nucleotide Sequence: 774 bp     [Download]
>gi|356875267|gb|JN837480|evfO|:13991-14764
ATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATGGCAACGAACTGG
AAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATACGCCGGAATGTCA
CTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTACCGTTATCCGGCACGACGGAGCC
TATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCGATGCGCTCATCC
GCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCATGACGGTGCAGC
TGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGTCTGGCGGACACC
CTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTGCCCCCACGGTGG
CGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGCAGATGATCCGAT
CGCCCCACGCGTTTCCCGGCCCGTAGCCCCCGCATCCGATCTGACAGGTGCAAACGGGATCAACACGCCG
TTTATGGATCTGCCGCCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCATGGCGCAGTACC
ACCTGGCCTGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTCTCAGGATGCGG
ATGA