SecReT6
Protein ID: 356875283
SecReT6 ID787
T6SS typei1
Gene symbolevfP
Locus tagEvfP
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]14781..15830 [-]
ProductEvfP
NoteTssG
UniProt IDG8IRM4, G8IRM4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-90, Aligned region: 20..336
Protein Sequence: 349 a.a.     [Download]
>gi|356875283|ref|AET37205.1| EvfP [Escherichia coli RS218]
MAGENGPARPDIATKPPLPADVRNCNFYVLMEALYRRHGAPGQDISLRTEPAREIVRFSSDASISFPGTD
LSALSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEFLDLFSHRWTQFAYHAWRKYR
YYICFRSGGTDTFSQRMYALVGLGNQSVRDRLAINHSKMLAYAGILATPGRAPEVICNLVSHCFDLPDVT
IERWQLRKVAIDPAHQNRLGVRNPKGKTAGHIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSF
LPDGENHLPLTMFLSFILRDQFAWDLRLCLAPQQAKGMRLSDPASSRLGRTSFIGQPKVPPAITIRIRE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|356875267|gb|JN837480|evfP|:14781-15830
ATGGCAGGAGAAAATGGGCCAGCACGCCCTGATATAGCGACAAAACCGCCGTTACCGGCGGATGTGCGCA
ACTGCAATTTCTATGTGCTGATGGAGGCGCTGTACCGTCGGCATGGCGCGCCGGGCCAGGACATTTCCCT
GCGTACCGAGCCTGCCCGGGAGATCGTGCGTTTCAGCTCTGACGCCAGTATCAGTTTTCCGGGTACGGAC
CTGAGTGCGCTTTCCCGTAGCCAGAACGGACAGTATGTACTGCAAACCCGGTTCCTGGGTTTTTCCGGCA
GCCAGTCGCCGCTACCGGGCTATTATCTGGATCAGATGGCGCAGGAGTCCGCACAGAACGAAGACGGCCT
GAAAGAATTTCTCGATCTATTCAGCCACCGCTGGACACAGTTTGCCTATCATGCCTGGCGCAAATACCGC
TACTACATCTGCTTTCGTAGCGGCGGTACTGACACCTTTTCACAGCGCATGTACGCACTGGTCGGGCTGG
GTAATCAGAGCGTGCGTGACAGGCTTGCCATTAACCACAGCAAAATGCTGGCCTACGCCGGAATTCTGGC
AACACCAGGCCGCGCGCCGGAGGTTATCTGTAATCTGGTGTCGCACTGTTTTGATTTGCCGGATGTCACC
ATTGAACGCTGGCAACTGCGTAAAGTCGCCATTGATCCGGCACACCAGAACCGGCTGGGTGTACGTAATC
CGAAAGGAAAAACGGCTGGACATATTCCGGGACGCTCCATACTCGGCGTTAATTTTACCCTCGGCGCACG
GGTGCCGGATCGCAGCGGAAAATTCCTGTTGCAGATTGGCGGCCTGTCGCGGGAGCGTTATCTCTCATTT
TTACCCGATGGCGAAAATCACCTGCCGCTGACCATGTTCCTTTCCTTTATTCTGCGCGACCAGTTTGCCT
GGGATTTACGGCTGTGCCTGGCGCCACAGCAGGCTAAAGGGATGCGCCTTAGCGATCCGGCCAGCTCCCG
CCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCATCACAATCCGAATCAGGGAATAA