SecReT6
Protein ID: 356875284
SecReT6 ID787
T6SS typei1
Gene symbolevfQ
Locus tagEvfQ
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]15794..17635 [-]
ProductEvfQ
NoteTssF
UniProt IDG8IRM5, G8IRM5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-190, Aligned region: 5..613
Protein Sequence: 613 a.a.     [Download]
>gi|356875284|ref|AET37206.1| EvfQ [Escherichia coli RS218]
MAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEFPEFTHG
LIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVSSVACHF
TLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYLWFCECL
MDAELIAGEYRLPLPDLWLEAAGFDNRDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPDDFP
INAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAYDIFQVS
TVTSKVKVSGTEISPGSQARVWPEFESFQHQMEYSRQREVVYWHHRTKTSLLHHGLEHSIAFVHADGSIP
GSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTLPLWPVTDGDMHWSLISAMN
LNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTLWIRPDP
FICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQESWEWQEKMGQHALI
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|356875267|gb|JN837480|evfQ|:15794-17635
GTGGCTTTTGAAGAACGTTACTACCGCGAAGAGCTGGATTATCTTCGCCAGCTAGGCAAACTGCTGGCGC
AGGAAAAACCACATCTGGCCCACTTTCTGGCCGAGAAAGAGGGTGATCCGGACGTGGAGCGTCTGATGGA
AGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTCCCCGAGTTCACCCATGGG
CTGATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGGTTATTGCCTATGAACCCA
AAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAGAAGCCGCTCAGAAAAGTC
CTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCTTCCGTAGCCTGCCATTTC
ACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCAACGCCAGCAGCCTGAAAG
AAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCTGAACAAAAT
CACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTGTGGTTTTGCGAATGCCTG
ATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGTGGCTGGAGGCGGCGGGTT
TTGACAACCGGGATGCTCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTACCGCGTGCTTCAGGAGTA
TTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCGCTACCAGACGATTTCCCG
ATCAATGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTGCGCCAGGATT
CGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAGGCCGGATGG
GCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTATGACATTTTTCAGGTCAGC
ACAGTCACCAGTAAAGTCAAAGTTTCAGGTACTGAAATCAGCCCAGGTAGCCAGGCGCGTGTCTGGCCCG
AATTTGAAAGCTTCCAGCACCAGATGGAGTACAGCCGCCAGCGAGAAGTCGTCTACTGGCATCACCGGAC
TAAAACGTCCCTGCTTCACCACGGGCTTGAACACTCTATCGCCTTTGTCCATGCAGACGGTAGCATTCCG
GGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCAACCGTATGATCCCTGCCC
GGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGCCTCATTTCGTAATGTCAC
GCGCCCGACACTGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCCGCGATGAAC
CTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACCTGCCAGGTG
CTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGAAAAACTCGAAACCAAACC
TGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGTCCCGATCCG
TTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCTTTGCCCTCTACGCCAGCA
TCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGTCCTGGGAATGGCAGGAGAAAAT
GGGCCAGCACGCCCTGATATAG