SecReT6
Protein ID: 356875285
SecReT6 ID787
T6SS typei1
Gene symbolevfR
Locus tagEvfR
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]17641..18066 [-]
ProductEvfR
NoteTssE
UniProt IDG8IRM6, G8IRM6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-20, Aligned region: 30..123
Protein Sequence: 141 a.a.     [Download]
>gi|356875285|ref|AET37207.1| EvfR [Escherichia coli RS218]
MLRRDSGPTGSLFERIREAANPPSYQNPKEALIRSIRRNLRQVLNTRSGSCYGSPELGITDLNDESLASS
DFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELCFHIVATVDVSETRGVFEFDILLDNHQRYCV
E
 
Nucleotide Sequence: 426 bp     [Download]
>gi|356875267|gb|JN837480|evfR|:17641-18066
ATGCTAAGACGGGATTCAGGACCAACCGGCAGTCTTTTTGAACGTATCCGTGAGGCGGCAAATCCGCCTT
CATATCAGAATCCAAAAGAAGCACTGATACGTTCCATCAGACGTAACCTGCGACAGGTCCTGAATACCCG
CTCCGGCAGTTGTTATGGTTCACCGGAGCTGGGGATTACTGATTTAAATGATGAATCGCTGGCCTCCAGC
GATTTCAGACGAGAAATCCGTAAGTCCATTAGCCAGTGCATTTTACATTACGAACCTCGTATTACCGATG
TTGTTGTTACGGCTGCTGCACCGGATGAATACGCCCCTGTGGAACTGTGTTTTCATATTGTGGCTACGGT
CGATGTCAGCGAAACCAGGGGAGTGTTTGAATTTGACATTTTGCTGGACAACCATCAACGCTATTGTGTG
GAGTGA