SecReT6
Protein ID: 356875286
SecReT6 ID787
T6SS typei1
Gene symbolevfS
Locus tagEvfS
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]18071..19126 [-]
ProductEvfS
NoteTssC
UniProt IDG8IRM7, G8IRM7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.40E-148, Aligned region: 7..349
Protein Sequence: 351 a.a.     [Download]
>gi|356875286|ref|AET37208.1| EvfS [Escherichia coli RS218]
MYIQAVTGQFGGEPVAAVIGNFAFKNTTPDMKLLKYISQVSAMAHSPFLSSVSSEFFGLDSWTELPGIKE
PGAIFEGPAYSRWRALRESEDSRYLGLTAPRFLLRHPYSPDENPVKTFRYHEDVSQSHESYLWGNTSFLL
AANLAESFAKYRWCPNIIGPSSGGAVKDLPVHLYESMGQMQAKIPTEVLITDRREYELAEEGFITLTMRK
GSDNACFFSANSVQKPKTFPKTPEGKAAETNYKLGTQLPYLFVISRLAHYIKVIQREQLGSWKERSDLER
ELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDVDGEPGWYQVAISVRPHFKYMGASFDLSLVGRLDK
E
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|356875267|gb|JN837480|evfS|:18071-19126
ATGTATATTCAAGCGGTTACCGGACAATTTGGCGGTGAGCCAGTGGCGGCGGTAATCGGCAACTTTGCCT
TTAAGAACACCACGCCGGATATGAAGCTGCTGAAATATATCAGCCAGGTCAGCGCGATGGCGCACAGCCC
GTTCCTGTCGTCAGTATCATCCGAATTTTTCGGTCTGGATTCATGGACAGAGTTACCGGGGATCAAAGAA
CCGGGTGCCATCTTTGAAGGCCCGGCCTACTCCCGCTGGCGCGCCCTGCGTGAATCGGAAGATTCCCGTT
ACCTGGGCCTGACCGCCCCCCGGTTCCTGCTGCGCCACCCTTACTCACCGGATGAAAACCCTGTCAAAAC
CTTCCGTTACCATGAAGATGTCAGCCAGAGTCATGAGTCTTATCTGTGGGGGAATACCTCGTTTTTACTG
GCCGCCAACCTGGCGGAAAGTTTTGCTAAGTATCGCTGGTGCCCAAATATTATTGGCCCTTCCAGCGGCG
GCGCAGTCAAAGACCTCCCGGTGCATCTGTATGAATCCATGGGGCAAATGCAGGCAAAAATTCCGACTGA
AGTGTTGATCACTGACCGGAGAGAGTATGAGCTGGCGGAAGAGGGCTTTATCACACTGACCATGCGTAAA
GGGTCTGATAATGCGTGCTTTTTCTCGGCCAACTCGGTGCAGAAACCCAAAACATTCCCCAAAACCCCCG
AAGGCAAGGCTGCGGAGACCAACTATAAACTCGGCACCCAGCTGCCATACTTGTTTGTTATCAGCAGGTT
AGCGCATTACATCAAGGTAATTCAGCGCGAACAGCTTGGCTCATGGAAAGAACGTAGTGACCTGGAGCGT
GAGCTGAACACCTGGATTCGCCAGTATGTTGCTGACCAGGAAAATCCGCCTGCCGAAGTCCGCAGCCACC
GGCCTTTGCGTCAGGCTAAGATCGAGGTACTGGATGTGGATGGTGAGCCGGGCTGGTACCAGGTCGCGAT
TTCTGTCAGACCGCATTTTAAATACATGGGTGCCAGTTTCGACCTGAGCCTGGTCGGACGACTGGATAAG
GAATAA