SecReT6
Protein ID: 356875287
SecReT6 ID787
T6SS typei1
Gene symbolevfT
Locus tagEvfT
StrainEscherichia coli RS218
Repliconchromosome [GenBank: JN837480] [Browse all T6SS(s) in this replicon]
Location [Strand]19089..19556 [-]
ProductEvfT
NoteTssC
UniProt IDG8IRM8, G8IRM8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-28, Aligned region: 67..152
Protein Sequence: 155 a.a.     [Download]
>gi|356875287|ref|AET37209.1| EvfT [Escherichia coli RS218]
MSVKEEIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAEPINILAVDAM
IADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLNVTQEELLDDFEFAPEITQSA
YYKHVYSSGYRTIWR
 
Nucleotide Sequence: 468 bp     [Download]
>gi|356875267|gb|JN837480|evfT|:19089-19556
ATGTCAGTAAAGGAAGAAATTGCTCCCGTCAGCGCGTCTCAAACCGCCGCGCCCCCATCTCTGCTTGATG
AAATCATGGCGCAAACCCGCGTCCAGCCTAAATCAGAAAGCTACGATATCACCCGCCAGGGCGTGAGCGC
CTTTATTGCCGCCATGTTACAGGGCGACAGTAGCGCTGAACCTATCAATATCCTGGCCGTTGACGCCATG
ATTGCTGATATTGATGCCCGAACCAGCAGGCAGATGGATGCCATTATTCATGCCCCGGAGTTTCAGGAAC
TGGAATCCCTGCTGCGCTCGCTGAAGCTGCTGGTTGAACGCGCGGATACACGGGAAAACATCAAAGTCCA
TTTCCTGAATGTCACTCAGGAAGAACTGCTGGATGATTTCGAATTTGCACCTGAAATCACGCAGTCTGCG
TATTACAAGCATGTATATTCAAGCGGTTACCGGACAATTTGGCGGTGA