SecReT6
Protein ID: 357405281
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1925
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2212255..2213724 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDG4T2V8
KEGG IDmah:MEALZ_1925
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 9.60E-14, Aligned region: 29..96
Protein Sequence: 489 a.a.     [Download]
>gi|357405281|ref|YP_004917205.1| FHA domain-containing protein [Methylomicrobium alcaliphilum 20Z]
MALSLKIATYKGKPLSEPKLVAFPNGEGTIGRSDDNTLVLPDPDKFVSRHHASIKYENGIYYLTDSSLAG
VFIDNEANPLRNDSTPLHNGTLLKVGEYEIETIITEDTRQDDFPFPDIFADSPSKPTEPEELFSTPIDTE
ANRLMGDSGSPFPRHEELIDAKESETPEFESHLQDHASPLFDSFIAPQVEAATKPFEEIPENLSFEDLFA
DSDTPSSDRQVEDDSRASSMDLLNESFAPKPFQADPEPSASEPFTPPLAPPDSPQTSNLNSILADPSDSS
PETPIAQPVQNISDTRLFDAFLQGAGLDQNECATKNQLEAMQRVGRMFRQLVAGTVSVLRSRAEFKSLFR
VNVTVIRAVDNNPLKFAVSTDDVLKQLIQNKEGGFLESVESIEQGFNDIMNHQLAMQAGIQASLTDLLKR
FDPKTIEKQFEQGIVLQKKSKCWDSYQETYRIESEEAVENFFGDAFVEAYEEQMKALTTARNKNEKFGL
 
Nucleotide Sequence: 1470 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2212255-2213724 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGCTTTATCTCTCAAGATCGCAACGTACAAAGGCAAGCCTTTATCCGAACCTAAACTAGTGGCTTTTC
CAAACGGCGAAGGCACGATAGGACGTTCCGATGATAATACGCTGGTTTTACCTGATCCTGATAAATTTGT
ATCTCGGCATCATGCATCGATCAAGTACGAAAACGGTATATATTATTTGACCGACTCTAGTCTGGCTGGC
GTATTTATCGATAACGAAGCTAACCCGCTACGTAACGATTCGACACCTCTCCATAACGGCACCCTTTTAA
AAGTCGGCGAATATGAAATAGAGACCATTATCACAGAAGACACTAGGCAGGATGATTTTCCTTTTCCGGA
TATTTTTGCCGATTCGCCGTCAAAACCGACAGAACCCGAAGAGTTGTTTTCAACGCCGATCGATACGGAA
GCCAATCGACTGATGGGCGATAGCGGTTCACCCTTTCCACGGCATGAAGAATTGATCGACGCCAAAGAAA
GCGAAACGCCCGAATTTGAAAGTCACTTGCAAGATCATGCTTCACCGCTTTTCGACAGCTTTATCGCTCC
TCAGGTAGAAGCGGCAACGAAACCTTTTGAGGAAATTCCTGAAAACTTGAGTTTCGAGGATCTTTTCGCC
GACTCCGATACACCCTCCAGCGATAGACAGGTAGAGGATGATTCGAGAGCATCGAGCATGGACTTGCTTA
ACGAGAGCTTCGCTCCGAAACCGTTTCAAGCCGATCCTGAGCCATCGGCTTCAGAGCCTTTTACACCCCC
GCTCGCCCCTCCTGATAGTCCGCAAACTTCAAATTTAAACAGCATTCTAGCCGACCCGTCCGATTCTTCC
CCTGAAACACCAATCGCACAACCCGTACAGAATATTTCCGATACGAGGCTATTCGATGCTTTTTTGCAAG
GTGCTGGACTTGATCAAAACGAATGCGCAACTAAAAATCAATTGGAGGCGATGCAACGAGTTGGCAGAAT
GTTTCGGCAATTAGTTGCCGGTACCGTGTCGGTCTTACGAAGCCGAGCCGAATTCAAGAGTTTATTTCGC
GTCAATGTGACCGTAATAAGAGCGGTCGACAATAATCCGTTGAAGTTCGCCGTTTCGACCGATGATGTTT
TGAAGCAATTGATTCAAAATAAAGAAGGCGGATTTCTCGAATCGGTCGAATCGATCGAGCAAGGCTTCAA
TGACATCATGAATCATCAGCTCGCCATGCAAGCAGGGATTCAAGCCTCATTGACCGACTTATTGAAACGA
TTCGACCCGAAAACGATCGAAAAACAATTCGAGCAAGGCATCGTGTTACAAAAAAAATCCAAGTGTTGGG
ACAGTTATCAGGAAACTTATCGCATTGAGTCCGAAGAAGCCGTTGAGAATTTTTTCGGCGATGCCTTCGT
AGAGGCTTATGAAGAACAAATGAAAGCCTTAACGACAGCGCGGAACAAAAATGAAAAATTTGGACTATGA