SecReT6
Protein ID: 357405282
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1926
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2214107..2215444 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDG4T2V9
KEGG IDmah:MEALZ_1926
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.30E-159, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|357405282|ref|YP_004917206.1| type VI secretion protein [Methylomicrobium alcaliphilum 20Z]
MAENNRTVWSEGMFLRPQHFQQHDRYIETFVKERCGNLTPYDWGVKKIAIDQRQLAMGKFALAECSGIFP
DGTPFNLPEDDDLPLPVDIPTDVQNNIVYLSLPVRQPGTIEIDTDENRHNLARYHAFESEVRDHNTGSNA
TSAILVGKLHTRLLLERQERSGHVCIGVARVIESRVDKNVILDQGFIPPSLDCNAVPILNGFIKELFGLL
HTRGEALGGRASEAGRGGVAEISDYMLLQMVNRVEPLFEHLQSIPALHPESFYRIAVQLAGELSTFCRPN
KRPVSFPVYRHDDLQTTFMHVMEELRQLLSAVLEQNAIPIPLTAPKYGIRGAKVPDPNLLKDAVFVLAAN
AQVSKEQLRSGFPTQVKIGPVEQIQQLVRSALPGISIHALPVAPRQIPYHAGFAYFELNKQSELWKQMAQ
SGGFAIHIAGEFPGLELEFWAIKNG
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2214107-2215444 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGCGGAAAATAACAGGACGGTTTGGTCGGAAGGCATGTTTTTGCGGCCCCAGCATTTTCAACAACACG
ACCGGTATATCGAAACCTTCGTCAAGGAACGATGCGGCAACCTTACGCCATATGATTGGGGCGTCAAAAA
AATTGCCATAGACCAGCGGCAGCTTGCCATGGGCAAATTCGCCTTGGCTGAATGCAGCGGGATTTTTCCG
GACGGAACGCCGTTTAATTTGCCTGAAGACGACGACTTGCCTTTACCCGTCGATATTCCTACCGACGTAC
AAAACAATATCGTTTACCTGTCGCTACCGGTTCGCCAACCGGGTACGATTGAAATCGATACCGACGAGAA
CCGCCATAATCTGGCGCGCTATCATGCCTTCGAAAGCGAAGTTCGCGACCATAATACCGGATCGAATGCA
ACCTCTGCGATCTTGGTCGGCAAGCTGCATACTAGGTTGTTATTGGAGCGGCAAGAGCGCTCCGGTCATG
TTTGTATCGGGGTGGCCAGAGTCATCGAGTCGAGGGTCGATAAAAACGTGATTCTCGATCAGGGTTTTAT
TCCGCCTTCGCTCGATTGCAATGCCGTGCCGATCTTGAACGGGTTTATCAAAGAGCTGTTCGGCTTATTG
CACACCCGCGGAGAAGCGCTCGGCGGCCGGGCTTCCGAAGCGGGCCGGGGGGGAGTTGCCGAAATTTCCG
ATTACATGCTGCTGCAAATGGTCAATCGTGTTGAGCCATTGTTTGAACATTTGCAATCCATTCCCGCATT
GCATCCGGAAAGTTTTTACCGAATTGCGGTGCAATTGGCCGGCGAGTTATCGACATTTTGCAGGCCCAAT
AAAAGACCGGTGAGTTTTCCGGTTTATCGGCACGACGATTTACAAACGACCTTTATGCATGTTATGGAGG
AGTTGCGGCAATTATTGAGCGCGGTATTGGAGCAAAACGCGATTCCGATTCCGTTGACAGCACCGAAGTA
CGGTATTCGCGGCGCGAAGGTGCCGGACCCGAATTTGCTCAAGGATGCCGTATTCGTGCTGGCCGCGAAT
GCGCAAGTATCGAAGGAACAATTGCGCAGCGGTTTTCCGACGCAAGTCAAAATCGGTCCGGTCGAACAGA
TTCAGCAATTGGTGCGTTCGGCCTTGCCCGGTATTTCGATTCATGCGCTGCCGGTCGCGCCCCGGCAGAT
TCCTTATCATGCGGGTTTCGCTTATTTCGAGCTTAACAAACAAAGCGAGCTATGGAAGCAAATGGCTCAA
TCGGGCGGTTTTGCTATCCATATCGCCGGTGAGTTTCCTGGGCTTGAACTTGAATTTTGGGCAATCAAAA
ACGGTTAA