SecReT6
Protein ID: 357405283
SecReT6 ID512
T6SS typei3
Gene symbolompA
Locus tagMEALZ_1927
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2215450..2216811 [+]
Producthypothetical protein
NoteTssL
UniProt IDG4T2W0
KEGG IDmah:MEALZ_1927
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-72, Aligned region: 58..261
OmpA [PF00691], Evalue: 4.90E-15, Aligned region: 187..207
OmpA [PF00691], Evalue: 4.90E-15, Aligned region: 342..440
Protein Sequence: 453 a.a.     [Download]
>gi|357405283|ref|YP_004917207.1| hypothetical protein MEALZ_1927 [Methylomicrobium alcaliphilum 20Z]
MNHDDPFGNYIDDDKTILRPTPGGRKPKPQEPMPTHAPDKAPMPPEGLHERIVYSKDNPLTACALSLLSL
VAQLRNTASHPDIAGLRDSVINEVKRFEAKALGRGVSPDQVQAARYCLCTLLDETVLNTPWGCNSIWSTH
SLLITFHKEAWGGEKFFQILKNIMQQPGTHLHLLELLYFCLCLGFEGKYRIQEHGMTRLEEVRENLYQII
QRQRGDIEKELSIQWQGIKDKRNVLTRLVPLWVIGAVVGMVLMLAYLGYLYFINAASNPLLAKLYAIKDG
LEPLQVAVAEPLPETPKSPDTPTAYSLYDDISSFLAPEIARGEVVLDRKNDKIALRIMGKGFFASGRDSI
TAKYYPLMNRIGEALTKVIGSILVVGHTDSDPIFSARFPSNWDLSRARAQSVADMLKSKPGIAATITSEG
RAETQPLVPNDSAEHKAMNRRVEIIFSGLKGQT
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2215450-2216811 Methylomicrobium alcaliphilum chromosome, complete genome
GTGAATCACGACGACCCATTCGGTAATTACATCGATGACGACAAAACCATCCTCAGGCCTACGCCGGGCG
GAAGAAAGCCCAAACCTCAGGAGCCGATGCCGACGCATGCACCCGATAAAGCGCCAATGCCTCCTGAAGG
CCTACACGAACGAATCGTCTATTCGAAAGATAATCCGTTGACCGCCTGCGCGTTGTCATTGTTGTCTTTA
GTCGCGCAATTACGCAATACCGCGTCGCATCCCGACATTGCCGGTCTGAGAGATAGCGTGATCAACGAAG
TCAAGCGTTTCGAAGCAAAAGCGCTAGGTCGCGGCGTATCGCCCGATCAAGTGCAGGCGGCGCGTTATTG
TCTTTGTACCTTACTCGACGAGACCGTATTAAATACGCCTTGGGGCTGCAACAGTATATGGAGCACGCAC
AGCCTGTTGATTACTTTTCATAAGGAAGCTTGGGGCGGAGAAAAGTTTTTCCAAATTTTGAAGAATATTA
TGCAACAGCCCGGCACCCATCTACATTTGCTGGAATTGTTGTATTTTTGCCTTTGCCTCGGGTTCGAAGG
GAAATACCGCATTCAGGAACACGGCATGACCCGGCTTGAAGAAGTTCGGGAAAATCTATATCAAATCATA
CAGCGGCAGCGCGGCGATATCGAAAAAGAGTTGTCTATACAATGGCAGGGCATCAAAGACAAACGTAACG
TGTTGACCCGCTTGGTGCCGCTATGGGTAATCGGCGCGGTGGTCGGTATGGTCCTGATGCTGGCCTATCT
CGGCTATCTCTATTTCATCAATGCCGCGTCCAATCCATTGTTGGCAAAACTTTATGCGATCAAGGACGGC
CTTGAGCCGCTACAAGTCGCAGTCGCTGAACCGTTGCCAGAAACGCCTAAATCTCCCGATACTCCTACAG
CTTATTCATTGTATGACGATATCAGCAGTTTTCTTGCGCCGGAAATTGCGCGCGGCGAAGTCGTGTTGGA
TCGCAAGAACGACAAAATCGCGTTACGCATCATGGGCAAGGGGTTTTTTGCTTCCGGTAGGGACTCGATA
ACCGCGAAATATTATCCGTTAATGAATAGAATCGGCGAAGCGCTCACCAAAGTCATCGGCAGTATTCTAG
TTGTCGGTCATACCGACAGCGATCCGATTTTTTCGGCGAGATTTCCATCCAATTGGGATTTATCGAGAGC
ACGCGCGCAGTCGGTTGCCGATATGCTCAAAAGCAAGCCGGGAATCGCTGCGACCATTACATCCGAAGGG
CGTGCGGAAACACAGCCGCTAGTGCCGAATGACAGCGCCGAACATAAAGCGATGAACCGTCGTGTCGAAA
TCATTTTTTCAGGATTAAAAGGACAAACGTGA