SecReT6
Protein ID: 357405286
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1930
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2221997..2223049 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDG4T2W3
KEGG IDmah:MEALZ_1930
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-21, Aligned region: 57..117
Protein Sequence: 350 a.a.     [Download]
>gi|357405286|ref|YP_004917210.1| type VI secretion-associated protein, ImpA family [Methylomicrobium alcaliphilum 20Z]
MSALSIDIEKYLQDIDPDNVCGDDLEYDPAFIALEQAIIGKPEQEIGDTIQEAEPPDWKEIKKSAEALLD
RTRDLRVLVYYLRSLIALEGLTGLSEGLKLIDTLIAKHWDAVYPRLDPDDDNDPTERVNILMALCDHETM
LRPLQLVSLVESKALGRFCFRDFMIAAEKMTVSEDDNAPKLGTIEAAVQDSDIAALQSNLASIVASAESL
NSLEDFVTQQVGINNAPNFEALRHLLKEFEHLLSGWLESRGVDDIDAPQVDPESQDEMASRPQATKKSIS
GAINNSQDVLNALKLICDYYKKNEPSSPVPLLLERAQRLVGKSFMDALMDIAPDGVSQASIIMGAKSEDE
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2221997-2223049 Methylomicrobium alcaliphilum chromosome, complete genome
GTGAGTGCATTGAGTATCGATATCGAAAAATATTTACAGGACATCGATCCTGATAATGTTTGCGGCGACG
ATCTGGAATACGACCCCGCTTTTATCGCGTTGGAGCAAGCCATAATCGGCAAGCCGGAACAGGAAATCGG
CGACACTATTCAAGAAGCCGAACCGCCGGACTGGAAGGAAATTAAAAAATCCGCTGAAGCCTTGCTAGAC
CGGACGCGCGATTTAAGAGTTCTGGTTTATTACTTGCGCTCCTTGATTGCACTCGAAGGACTTACCGGTC
TTAGCGAAGGATTAAAGTTAATCGACACATTGATCGCAAAGCACTGGGACGCTGTGTATCCTCGGCTCGA
CCCCGATGACGACAATGACCCTACTGAGCGCGTTAATATTTTGATGGCTTTATGCGATCATGAAACGATG
TTGCGTCCTTTGCAGCTTGTTTCTTTAGTCGAGTCGAAAGCATTAGGCCGTTTTTGTTTTCGCGATTTCA
TGATTGCCGCCGAGAAAATGACGGTTTCCGAAGATGATAATGCCCCGAAATTAGGGACTATCGAAGCCGC
TGTTCAGGATAGCGATATTGCTGCATTACAAAGTAATTTGGCATCGATCGTGGCAAGCGCCGAAAGCCTG
AATAGTTTGGAAGACTTCGTTACTCAGCAAGTAGGCATCAACAATGCTCCTAACTTTGAGGCGCTTAGGC
ACTTATTGAAGGAGTTCGAGCATTTGTTATCGGGCTGGCTGGAGTCGCGCGGGGTCGACGACATCGACGC
CCCACAAGTCGATCCGGAAAGCCAGGACGAGATGGCAAGTAGACCGCAAGCCACAAAAAAATCGATCTCA
GGTGCCATCAATAACAGTCAAGATGTCCTCAATGCGCTCAAGTTGATTTGCGACTATTATAAAAAAAACG
AGCCGTCGAGTCCTGTGCCGTTGCTTCTTGAGCGGGCGCAGCGGCTAGTCGGAAAAAGTTTCATGGATGC
ACTCATGGATATTGCGCCGGACGGCGTTAGCCAAGCCAGTATCATCATGGGGGCTAAAAGTGAAGATGAA
TAA