SecReT6
Protein ID: 357405287
SecReT6 ID512
T6SS typei3
Gene symbolsciH
Locus tagMEALZ_1931
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2223097..2223627 [+]
Productcytoplasmic protein,SciH
NoteTssB
UniProt IDG4T2W4
KEGG IDmah:MEALZ_1931
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.90E-61, Aligned region: 9..161
Protein Sequence: 176 a.a.     [Download]
>gi|357405287|ref|YP_004917211.1| cytoplasmic protein,SciH [Methylomicrobium alcaliphilum 20Z]
MAESSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVLADLSGKPADPLAPVADRKMLEIDVDNFND
RLKAMKPRVAFTVPNTLTGEGNLNVDLTFESMDDFSPAAVARKVDGLNKLLEARTQLANLVTYMDGKGGA
EELIAKVINDPALLQSLTAAPKPADPAEAKTEEGGE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2223097-2223627 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGCTGAAAGCAGTCAAAAGTTTATCGCGCGTAATCGTGCGCCGCGAGTACAAATCGAATACGATGTCG
AACTCTATGGTGCGGAGAAAAAAGTTCAACTGCCTTTCGTGATGGGAGTACTCGCTGATTTGTCGGGAAA
ACCCGCCGATCCATTGGCGCCTGTCGCAGATCGTAAAATGCTCGAAATCGATGTGGACAACTTCAATGAT
CGACTCAAGGCAATGAAACCTCGTGTCGCATTTACGGTGCCCAACACCTTGACGGGTGAAGGCAATTTGA
ATGTCGATCTTACTTTCGAAAGCATGGATGATTTTTCGCCGGCGGCTGTGGCAAGAAAAGTAGACGGACT
GAATAAATTGTTGGAAGCGAGAACGCAATTGGCAAATTTGGTCACTTATATGGACGGAAAAGGCGGCGCC
GAAGAATTGATAGCGAAGGTAATCAATGATCCGGCTTTATTGCAGTCGCTGACCGCTGCGCCGAAGCCGG
CCGATCCAGCCGAAGCAAAAACCGAGGAAGGAGGAGAGTAA