SecReT6
Protein ID: 357405288
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1932
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2223631..2225130 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDG4T2W5
KEGG IDmah:MEALZ_1932
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.50E-193, Aligned region: 68..494
Protein Sequence: 499 a.a.     [Download]
>gi|357405288|ref|YP_004917212.1| type VI secretion protein EvpB [Methylomicrobium alcaliphilum 20Z]
MAEAEQATEAEVTTGEVAEGSDFSALLTKEFKPKSERAKEEVESAVQTLAEFVLKDTSLVSDDAIASIES
IIAQIDSKLTEQINKILHHEDFKKLEGTWRGLHYLVNNTETDEMLKIRVMNISKNELGKTLKKFKGTAWD
QSPMFKKLYEEEYGQFGGEPFGCLMGDYYFDHSPPDVELLNQIAKISAASHAPFITGLSPTTLQMDSWGE
LANPRDLTKIFSTPEYAAWRSLRDSDDSKYLGMAMPRFLSRLPYGAKTDPVEEFDFEENTEAANSANYTW
SNAAYAMATNINRSFKLYGWCSRIRGIESGGAVEGLPVHTFPTDDGGVDMKCPTEIAISDRREAELAKSG
FMPLIHKKNSDFAAFIGAQSLHKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKERD
DMERWLNSWISNYVLTNPALATEEDKAIRPLSAAEVVVEEVEGNPGYYASKFYLRPHYQLEGLTVSLRLT
SKLPSQKGG
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2223631-2225130 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGCTGAAGCAGAACAGGCAACAGAAGCAGAAGTAACGACCGGAGAGGTCGCTGAAGGCAGCGATTTTT
CGGCATTATTGACCAAGGAATTCAAACCGAAATCCGAACGAGCGAAAGAAGAAGTTGAAAGCGCGGTTCA
AACGCTTGCCGAATTTGTTTTAAAGGATACTTCGTTGGTATCCGATGACGCGATAGCTTCAATCGAGTCT
ATCATCGCGCAAATCGATAGTAAATTGACCGAACAAATCAACAAAATACTGCATCATGAAGACTTTAAAA
AACTAGAAGGTACTTGGCGAGGACTGCATTATTTAGTCAACAATACCGAAACCGACGAGATGCTTAAAAT
TCGGGTCATGAACATCTCAAAGAACGAGTTAGGTAAGACGCTCAAGAAGTTTAAAGGGACGGCTTGGGAT
CAGAGTCCCATGTTCAAAAAATTGTATGAAGAAGAATATGGTCAATTTGGCGGCGAACCCTTCGGCTGTT
TAATGGGGGATTATTATTTCGATCATTCACCGCCCGACGTCGAATTATTGAATCAAATTGCGAAAATTTC
CGCCGCATCGCATGCACCGTTTATTACCGGTTTGTCGCCGACTACATTGCAAATGGACTCATGGGGTGAA
TTAGCTAACCCTAGAGATTTGACCAAAATCTTTTCCACCCCCGAGTATGCGGCTTGGCGATCGTTACGAG
ATTCCGACGATTCCAAATATTTGGGAATGGCGATGCCGAGATTTTTGTCCCGTCTGCCTTATGGAGCAAA
AACCGATCCGGTTGAGGAATTCGATTTCGAAGAAAATACCGAAGCGGCCAACAGCGCCAATTACACTTGG
TCTAACGCGGCCTATGCGATGGCGACCAACATTAACCGCTCATTTAAACTTTATGGCTGGTGTTCAAGAA
TTCGCGGCATAGAATCCGGCGGTGCAGTCGAAGGTTTGCCGGTCCATACCTTTCCGACCGATGACGGCGG
CGTCGATATGAAATGTCCGACTGAGATCGCGATCAGCGACCGCCGCGAAGCGGAATTGGCTAAGTCCGGA
TTCATGCCATTGATTCACAAGAAAAATTCGGATTTCGCCGCATTTATAGGTGCGCAGTCGCTGCATAAAC
CGGCTGAATACGACGATCCCGATGCAACGGCAAATGCCAATCTAGCTGCGAGATTGCCGTATTTATTCGC
AACTTGCCGGTTCGCGCATTATTTGAAATGTATCGTCAGGGATAAAATCGGGTCGTTTAAAGAGCGCGAC
GATATGGAAAGATGGCTCAATAGCTGGATCAGTAATTACGTTCTGACTAATCCGGCATTGGCGACGGAAG
AGGATAAAGCCATTCGTCCTTTATCTGCCGCCGAGGTGGTTGTTGAAGAAGTCGAAGGTAACCCGGGTTA
CTATGCGTCCAAATTTTATTTGAGACCGCATTATCAGTTGGAAGGCTTGACTGTTTCCTTACGACTCACT
TCCAAATTGCCTTCACAAAAAGGCGGCTGA