SecReT6
Protein ID: 357405290
SecReT6 ID512
T6SS typei3
Gene symbolsciE
Locus tagMEALZ_1934
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2226088..2226915 [+]
Productcytoplasmic protein,sciE
NoteTagJ
UniProt IDG4T2W7
KEGG IDmah:MEALZ_1934
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.70E-46, Aligned region: 146..269
TPR_16 [PF13432], Evalue: 5.20E-08, Aligned region: 14..67
TPR_16 [PF13432], Evalue: 5.20E-08, Aligned region: 105..140
TPR_19 [PF14559], Evalue: 5.00E-05, Aligned region: 15..70
TPR_19 [PF14559], Evalue: 5.00E-05, Aligned region: 118..140
TPR_19 [PF14559], Evalue: 5.00E-05, Aligned region: 223..257
TPR_2 [PF07719], Evalue: 0.0013, Aligned region: 15..38
TPR_2 [PF07719], Evalue: 0.0013, Aligned region: 53..61
TPR_2 [PF07719], Evalue: 0.0013, Aligned region: 79..84
TPR_2 [PF07719], Evalue: 0.0013, Aligned region: 110..129
Protein Sequence: 275 a.a.     [Download]
>gi|357405290|ref|YP_004917214.1| cytoplasmic protein,sciE [Methylomicrobium alcaliphilum 20Z]
MTLAEDRYMLSSEQALKDGNLEQALADIQQAVRKDPANVKNRIFLFQLLSVIGQWERALTQLNVLADMDA
ATLAMVQTYREALRCEVLRKEVFSGLKTPLIFGEPQQWMALLLQSLNLAAQEKYQEAQNLRNQAFDGAPA
TAGSIDGERFDWLADADVRLGPMLEAIINGQYYWVPFQHINTIQIELPEDLRDLVWMPVHFAWQNGGEAV
GFIPTRYVNSETNPDAAIQLARKTEWQEPHDGLFIGLGQRLLSTNHNDYALMDVREISFDGTDNI
 
Nucleotide Sequence: 828 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2226088-2226915 Methylomicrobium alcaliphilum chromosome, complete genome
ATGACGCTAGCCGAGGACCGATACATGTTAAGCAGTGAACAAGCATTGAAAGACGGTAATCTTGAACAAG
CATTGGCCGACATTCAACAGGCCGTGAGAAAAGATCCAGCCAATGTCAAAAATAGAATTTTCCTCTTTCA
ATTATTATCGGTTATAGGTCAATGGGAAAGAGCGTTGACCCAACTCAATGTCTTGGCTGACATGGATGCG
GCAACTCTGGCGATGGTACAAACCTATCGTGAGGCACTTCGTTGCGAAGTATTGCGTAAAGAAGTTTTCT
CAGGCTTGAAAACACCGTTGATTTTTGGCGAGCCTCAACAATGGATGGCCTTGTTGTTGCAATCTCTCAA
CCTCGCTGCGCAAGAAAAATACCAGGAGGCTCAAAACCTGCGCAATCAAGCTTTTGATGGCGCTCCGGCC
ACGGCCGGTTCAATTGATGGCGAACGTTTTGACTGGTTGGCGGATGCCGATGTCCGGCTCGGCCCCATGC
TCGAAGCAATCATTAATGGGCAATATTATTGGGTTCCTTTTCAACATATCAACACTATCCAAATAGAATT
GCCCGAAGACCTGCGCGATTTGGTTTGGATGCCTGTGCATTTTGCTTGGCAAAATGGCGGCGAAGCGGTC
GGGTTTATTCCGACACGTTATGTCAACTCCGAAACTAATCCGGATGCGGCTATTCAACTGGCGCGCAAGA
CCGAATGGCAAGAACCGCATGATGGGTTATTCATCGGTCTGGGACAGCGCTTATTAAGCACTAATCACAA
TGATTATGCCTTGATGGATGTCCGTGAAATTAGTTTTGATGGCACTGATAACATATAA