SecReT6
Protein ID: 357405291
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1935
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2226919..2227419 [+]
Producthypothetical protein
NoteTssE
UniProt IDG4T2W8
KEGG IDmah:MEALZ_1935
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.80E-20, Aligned region: 36..143
Protein Sequence: 166 a.a.     [Download]
>gi|357405291|ref|YP_004917215.1| hypothetical protein MEALZ_1935 [Methylomicrobium alcaliphilum 20Z]
MAELTQKERLQPSLLDRLTDDEPNNRVESRDKRVLSMQRLRQSVLRDVSWLLNADSFESVADLTDYPEVA
QSVINFGIQNLAGTSVVGADLTNIERKLKQAISVFEPRILPNSLSVKVLSADVMSHQAISFDIEANLWAQ
PLPIHLYLRTEIDVLTGDVNLRDMGG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2226919-2227419 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGCCGAATTAACCCAAAAAGAACGCCTCCAACCTTCGTTACTCGATCGATTGACGGATGATGAGCCGA
ACAATCGGGTTGAATCCAGAGATAAGCGGGTGTTATCGATGCAGAGATTGAGGCAGTCGGTCCTGCGCGA
CGTTTCCTGGCTATTGAATGCCGATTCCTTCGAGTCCGTTGCCGATTTAACGGATTATCCGGAAGTCGCT
CAGTCGGTTATCAATTTCGGCATACAAAATCTAGCGGGTACTTCCGTGGTCGGCGCGGACTTGACCAATA
TAGAAAGAAAACTTAAACAAGCCATTTCCGTCTTTGAGCCGCGAATTCTTCCCAATAGTTTGTCGGTTAA
AGTATTGTCGGCGGATGTCATGAGTCATCAAGCTATCAGCTTCGATATCGAGGCCAATCTTTGGGCGCAG
CCCCTTCCGATACATCTTTATTTACGGACTGAGATCGATGTATTGACTGGCGATGTTAATCTACGCGACA
TGGGCGGCTAA