SecReT6
Protein ID: 357405292
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1936
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2227423..2229303 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDG4T2W9
KEGG IDmah:MEALZ_1936
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-218, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|357405292|ref|YP_004917216.1| type VI secretion protein [Methylomicrobium alcaliphilum 20Z]
MDPKLLRYYNTELHHLREMGGEFAVEFPKIAARLGMDSFECADPYVERLLEGFAFLAARVQLKLDAEFPR
FTQHLLEMIYPNYLEPTPSMAVVQFQPDLTEGSLNEGFTIERATALRSQTTKGEQTPCEYRTAHEIKLWP
LQIHEAEYLPNLGAVANLCAHNLTGVKAAIRIRLKTTAGLKFNELKLDSLPVFLRGHGELPMHLYEQLIG
DSLAVCMQPTEKPYRWQHLVKDNAVTRIGFSDEEALLNYSPRSFQGYRLLQEYFAFPERFMFAEFNGFAQ
ALNQCDAEEMDLIVLLKRSHAKLINAVDRSQFALFCTPAINLFPKHADPIYIDRKSSEFHIIPDRSRPMD
FEICQVKEVIGIGSGGVNEKKEFQPFYRYSDERSHDVRPAYYSLHRQQRIASSKQKRQGPRSSYIGNETF
ITLVDGQSAPYSNDLKQLSIKALCSNRDLPLLMPLGGGKTDFTMQKGAPVQSIRCLSGPTKPRSSTAYGN
VNWSLINHLSMNYLSLIDRNDKEGAVALRSLLKLYSEYNVAAITNQIEGLLSIQAKDIVRRINTAGPIVF
GRGLEITLNFEESAFEGSGVFLMGAVLENFLARYVSINSFTETVVKSPDRGEIIRWPARIGRRKTI
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2227423-2229303 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGATCCGAAATTATTGCGCTATTACAACACGGAACTACACCATTTGAGGGAAATGGGCGGCGAATTTG
CCGTCGAATTCCCTAAGATTGCAGCGCGCTTGGGCATGGATAGCTTTGAATGCGCAGATCCTTATGTCGA
AAGATTATTGGAAGGTTTTGCCTTTTTAGCGGCACGCGTCCAATTGAAGCTCGATGCCGAGTTTCCGCGA
TTTACCCAGCACTTGCTGGAAATGATCTATCCGAATTATCTCGAGCCGACACCGTCTATGGCCGTCGTGC
AATTTCAACCCGATTTAACGGAAGGTTCGTTAAATGAAGGTTTTACGATAGAAAGAGCAACCGCGTTACG
CAGCCAGACGACAAAAGGCGAACAAACCCCCTGCGAATATCGCACCGCGCACGAAATCAAACTTTGGCCT
TTACAAATCCACGAAGCGGAATATCTGCCCAATCTTGGGGCCGTGGCAAACCTCTGCGCACATAATCTGA
CCGGGGTAAAAGCCGCGATTCGCATCCGGCTCAAAACCACGGCAGGTTTGAAATTCAATGAGTTAAAATT
GGATTCCTTACCCGTTTTTTTAAGAGGGCATGGCGAATTGCCGATGCACTTGTATGAACAATTGATTGGC
GATTCGTTAGCCGTTTGCATGCAGCCGACCGAAAAACCTTATCGCTGGCAACATTTAGTCAAAGATAATG
CGGTAACCCGGATAGGCTTTTCCGATGAAGAAGCCTTGCTCAATTATTCGCCTCGTTCTTTCCAGGGGTA
CCGTCTTCTGCAAGAATATTTTGCCTTTCCGGAACGCTTTATGTTTGCAGAATTTAACGGTTTCGCTCAA
GCGTTGAATCAGTGCGATGCCGAAGAGATGGATTTAATCGTTCTGCTAAAACGAAGTCACGCAAAACTGA
TTAATGCCGTCGATAGATCTCAATTTGCGTTGTTTTGTACTCCGGCGATCAATCTGTTTCCCAAGCATGC
CGATCCTATTTATATCGATCGGAAGTCGTCCGAATTTCATATCATTCCGGACCGCTCCAGACCGATGGAC
TTTGAAATTTGCCAAGTCAAGGAGGTCATTGGCATTGGGAGCGGGGGCGTCAATGAAAAAAAGGAATTTC
AGCCGTTTTATCGATACAGCGACGAACGCAGCCATGACGTCCGGCCTGCTTATTATTCGTTACATCGGCA
ACAACGGATAGCTTCGTCGAAACAAAAACGTCAAGGACCGCGATCGAGTTATATCGGCAATGAGACCTTT
ATTACGCTGGTCGACGGGCAATCGGCGCCTTACAGTAACGACCTTAAACAACTATCGATCAAGGCGCTTT
GTAGTAATCGCGATTTACCGTTGCTGATGCCGTTGGGCGGAGGAAAAACCGACTTCACGATGCAGAAGGG
CGCGCCGGTACAAAGCATCCGTTGCCTTTCAGGTCCCACTAAACCTCGGTCGTCGACCGCCTATGGCAAT
GTCAATTGGAGTTTAATCAATCATTTGTCGATGAACTATTTAAGTTTAATCGACCGTAATGACAAAGAAG
GTGCCGTCGCTCTGAGAAGTTTATTGAAGTTATATAGCGAATACAATGTTGCAGCTATTACTAATCAGAT
CGAGGGATTGTTGTCGATTCAAGCGAAAGATATCGTCAGACGAATCAATACGGCCGGCCCTATCGTTTTT
GGGCGCGGCTTAGAAATAACCTTGAACTTCGAAGAGTCTGCTTTTGAAGGCAGCGGCGTCTTCTTGATGG
GAGCAGTGCTGGAAAATTTTTTAGCCCGCTATGTTTCAATTAACTCGTTTACCGAAACCGTGGTCAAGTC
CCCGGATCGGGGAGAAATCATTAGATGGCCGGCGAGAATAGGTCGAAGAAAAACGATTTAA