SecReT6
Protein ID: 357405293
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1937
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2229357..2230283 [+]
Producthypothetical protein
NoteTssG
UniProt IDG4T2X0
KEGG IDmah:MEALZ_1937
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-100, Aligned region: 1..292
Protein Sequence: 308 a.a.     [Download]
>gi|357405293|ref|YP_004917217.1| hypothetical protein MEALZ_1937 [Methylomicrobium alcaliphilum 20Z]
MIECSHDDKPLIGQSSRPVDDAVRFGQEVSMAFESSTMSQFITAQEGKPARLTQRFLGLFGPNGPMPLHL
TEYVRSREHNFHDHTLARFGDIFHHRMVALFYRAKADAEPAFSFDRPDQNRFGDYLGALAGIGDEVFQDR
DAMPDLAKFHYIGHLANQAKNADGLIAILADFYKLPVRLNEFIGEWLQIETEDLTRLGESAQTGRLGESV
VLGSRVWSCQHKFRILFGPLTLTEYVSLLPSGQRLEKLIAIVRNYSGFEFDWDVNLILKNDEVPMSQLDG
CTRLGWTSWLGERHSTEDANDLLLNPIR
 
Nucleotide Sequence: 927 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2229357-2230283 Methylomicrobium alcaliphilum chromosome, complete genome
TTGATTGAATGTAGTCATGACGATAAACCTTTGATAGGACAATCCAGTCGGCCTGTAGACGACGCGGTAA
GGTTTGGTCAAGAAGTCTCCATGGCATTTGAGTCGTCGACAATGAGTCAATTTATTACGGCTCAGGAAGG
GAAGCCGGCCCGATTGACACAGCGTTTTTTAGGGCTGTTCGGACCCAACGGTCCGATGCCCTTGCATCTG
ACTGAATATGTGCGAAGCCGGGAGCATAATTTTCATGATCATACTCTGGCCCGATTTGGCGATATTTTTC
ATCACCGCATGGTTGCGTTATTCTATCGCGCCAAAGCGGATGCCGAACCTGCTTTCAGTTTCGACCGACC
CGACCAAAACCGATTTGGCGATTATTTAGGAGCGTTAGCCGGGATCGGCGATGAGGTGTTTCAAGATCGC
GATGCGATGCCGGATCTGGCCAAGTTTCATTACATAGGCCATTTAGCGAATCAGGCTAAAAATGCCGACG
GGCTGATCGCTATCCTGGCCGATTTCTATAAATTACCGGTGAGACTCAATGAGTTCATCGGCGAATGGTT
ACAGATCGAAACCGAGGATTTGACCCGATTGGGTGAATCGGCCCAAACCGGTAGATTGGGCGAGTCGGTC
GTATTGGGCTCCAGAGTTTGGAGTTGTCAGCATAAATTCCGGATTCTGTTCGGGCCTTTGACCCTAACAG
AGTATGTCAGTTTGCTGCCTTCCGGTCAGCGATTGGAAAAACTGATTGCGATCGTACGAAACTACAGCGG
CTTCGAGTTCGATTGGGATGTTAATCTAATCTTGAAAAATGACGAGGTACCGATGAGTCAATTGGACGGC
TGCACGCGACTGGGTTGGACTAGCTGGCTTGGCGAGCGGCACAGCACTGAAGATGCGAACGATCTGTTGC
TGAATCCGATACGGTAA