SecReT6
Protein ID: 357405294
SecReT6 ID512
T6SS typei3
Gene symbolclpV
Locus tagMEALZ_1938
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2230618..2233335 [+]
Productprotein ClpV1
NoteTssH
UniProt IDG4T2X1
KEGG IDmah:MEALZ_1938
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.80E-39, Aligned region: 237..256
AAA_2 [PF07724], Evalue: 3.80E-39, Aligned region: 638..805
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 236..370
AAA [PF00004], Evalue: 2.00E-19, Aligned region: 644..728
ClpB_D2-small [PF10431], Evalue: 1.90E-15, Aligned region: 811..889
AAA_16 [PF13191], Evalue: 8.20E-14, Aligned region: 213..257
AAA_16 [PF13191], Evalue: 8.20E-14, Aligned region: 280..315
AAA_16 [PF13191], Evalue: 8.20E-14, Aligned region: 541..554
AAA_16 [PF13191], Evalue: 8.20E-14, Aligned region: 632..688
AAA_5 [PF07728], Evalue: 9.20E-13, Aligned region: 236..260
AAA_5 [PF07728], Evalue: 9.20E-13, Aligned region: 342..366
AAA_5 [PF07728], Evalue: 9.20E-13, Aligned region: 643..760
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 235..317
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 365..402
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 533..556
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 641..674
AAA_22 [PF13401], Evalue: 2.90E-07, Aligned region: 705..726
Sigma54_activat [PF00158], Evalue: 5.20E-07, Aligned region: 214..255
Sigma54_activat [PF00158], Evalue: 5.20E-07, Aligned region: 643..761
AAA_14 [PF13173], Evalue: 2.30E-06, Aligned region: 236..334
AAA_14 [PF13173], Evalue: 2.30E-06, Aligned region: 642..742
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 214..255
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 288..320
Arch_ATPase [PF01637], Evalue: 1.30E-05, Aligned region: 643..687
NACHT [PF05729], Evalue: 3.60E-05, Aligned region: 236..343
NACHT [PF05729], Evalue: 3.60E-05, Aligned region: 644..670
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 231..313
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 640..668
Zeta_toxin [PF06414], Evalue: 7.00E-05, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 7.00E-05, Aligned region: 638..693
AAA_18 [PF13238], Evalue: 8.10E-05, Aligned region: 236..256
AAA_18 [PF13238], Evalue: 8.10E-05, Aligned region: 645..673
AAA_17 [PF13207], Evalue: 0.00017, Aligned region: 236..256
AAA_17 [PF13207], Evalue: 0.00017, Aligned region: 495..510
AAA_17 [PF13207], Evalue: 0.00017, Aligned region: 643..681
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 220..259
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 643..666
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 236..255
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 641..666
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 228..252
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 641..668
T2SE [PF00437], Evalue: 0.0032, Aligned region: 204..257
T2SE [PF00437], Evalue: 0.0032, Aligned region: 640..720
NTPase_1 [PF03266], Evalue: 0.0036, Aligned region: 236..257
NTPase_1 [PF03266], Evalue: 0.0036, Aligned region: 290..313
NTPase_1 [PF03266], Evalue: 0.0036, Aligned region: 643..668
ResIII [PF04851], Evalue: 0.0068, Aligned region: 220..253
ResIII [PF04851], Evalue: 0.0068, Aligned region: 296..317
ResIII [PF04851], Evalue: 0.0068, Aligned region: 615..670
UPF0079 [PF02367], Evalue: 0.0074, Aligned region: 236..256
UPF0079 [PF02367], Evalue: 0.0074, Aligned region: 641..671
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 236..247
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 641..661
Protein Sequence: 905 a.a.     [Download]
>gi|357405294|ref|YP_004917218.1| protein ClpV1 [Methylomicrobium alcaliphilum 20Z]
MGDISRVALFGKLNKVCYKSIEGATVFCKMRGNPYVELTHWLHQILQLQDSDLHKIIRQFNLDPSKLARD
FTESLDRLPRGSTSISDLSSHVEEAVERGWVYGTLMFGESQVRSGHLVVGILKTKGLNHALLEISNEFGK
VKPDTLTERFAEIVSGSPEEGLHSSDGFQVGGGAVPGEASGAMSPAQMGKQEALKQFTVDLTEQARQGKM
DPIVGRDEEIRQVIDILMRRRQNNPILTGEAGVGKTAVVEGFAQKIVAGDVPPSLLDVTLRTLDVGLLQA
GASMKGEFENRLRQVIEEVQSSEKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWA
EYKKHIEKDPALTRRFQVVQVLEPNEEKAILMMRGVASVMEKHHQVQILDEALEAAVKLSHRYIPARQLP
DKSVSLLDTASARVAISQHAVPAAVDDCRKRINGLDTELAIIGREKSVGVDIKDRETIVLEKLKAEKDRL
ALLEERWNNERELVKNILDIRQKLREQGGKVEGTDSKLEKAVDEVAGVDSESATRNGLLENLKNLLSQLH
DLQGESPLILPSVDAQAVASVVGDWTGIPVGRMVKNEIETIIHLADAIEQRIIGQRHALEMIARRIQTSR
AGLDNPNKPIGVFMLAGTSGVGKTETALALAEALYGGEQNVITINMSEYQEAHTVSTLKGAPPGYVGYGE
GGVLTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGWMEDGEGRVIDFKNTLILLTTNAGTELIANL
CKDPDLMPEPEGIAKALREPLLKVFPPALLGRLVVIPYYPLSDEMIAAIAKLQLKRIEKRIVENHKVPFS
YDEDVIKLIAERCTEVESGGRMIDAILTNTVLPSISSEFLTRMMEGKTVERVHVGVADGEFIYEF
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2230618-2233335 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGGCGATATCAGCCGTGTCGCGTTATTCGGTAAGCTGAATAAAGTGTGCTACAAATCCATAGAGGGCG
CTACCGTGTTTTGTAAAATGCGCGGCAATCCTTATGTAGAATTAACGCATTGGTTGCATCAAATTCTTCA
GTTGCAAGACTCGGATCTCCATAAAATCATTCGTCAATTCAATCTCGACCCCTCCAAATTGGCGCGCGAC
TTTACCGAATCTTTGGATCGCCTCCCAAGAGGCTCTACATCGATTTCCGATTTATCGTCGCATGTCGAAG
AGGCTGTCGAGAGAGGATGGGTATACGGTACATTAATGTTCGGCGAATCGCAGGTACGTTCGGGACATTT
GGTTGTCGGCATTCTTAAAACGAAGGGTTTGAATCATGCCTTGCTCGAAATTTCCAACGAATTTGGAAAA
GTCAAGCCGGATACCTTAACCGAACGTTTCGCGGAGATTGTCAGCGGCTCGCCTGAAGAAGGTCTGCATT
CAAGCGACGGTTTTCAAGTCGGAGGAGGGGCTGTTCCGGGCGAAGCCAGCGGCGCGATGTCGCCGGCGCA
GATGGGTAAACAAGAAGCCTTGAAACAATTCACTGTCGATTTAACCGAACAGGCGCGACAAGGCAAGATG
GACCCGATCGTTGGGCGCGATGAAGAAATCCGGCAGGTCATCGATATTTTGATGCGTCGACGTCAAAACA
ACCCGATATTGACTGGCGAGGCCGGCGTCGGCAAAACTGCCGTCGTTGAAGGCTTCGCGCAGAAGATCGT
CGCCGGGGACGTGCCGCCGTCCTTGCTGGACGTCACGTTGCGTACGCTTGATGTCGGTTTGCTGCAGGCA
GGCGCCAGTATGAAAGGCGAATTCGAGAACCGCTTACGTCAAGTGATCGAGGAAGTGCAATCATCCGAAA
AACCTATCATTTTGTTTATCGACGAAGCGCATACCTTGGTCGGCGCTGGCGGCGCAGCCGGCACCGGCGA
TGCAGCGAATCTTTTAAAACCGGCTCTGGCTCGAGGTACGCTCAGAACCGTCGCGGCTACGACTTGGGCC
GAATATAAGAAACATATCGAAAAAGATCCGGCATTGACGCGGCGCTTTCAAGTCGTGCAAGTACTGGAGC
CGAATGAGGAAAAAGCGATACTGATGATGCGAGGTGTCGCATCTGTCATGGAAAAACACCATCAGGTTCA
AATACTCGATGAGGCTCTGGAAGCTGCGGTAAAGCTGTCTCACCGATATATTCCCGCCAGGCAGTTGCCC
GATAAATCGGTTAGTTTGCTAGATACTGCATCGGCACGCGTAGCAATCAGCCAGCATGCCGTTCCTGCCG
CAGTCGATGATTGCCGAAAACGGATTAACGGATTGGATACGGAATTGGCGATCATCGGCAGAGAAAAGTC
GGTTGGCGTCGATATCAAAGACCGCGAAACGATTGTTCTGGAAAAACTTAAAGCCGAAAAAGATCGCTTG
GCGTTGTTAGAAGAGCGCTGGAACAACGAACGTGAGCTCGTAAAAAACATTTTAGATATTCGTCAAAAAC
TGCGAGAACAGGGCGGTAAAGTCGAGGGGACCGACAGCAAACTCGAAAAAGCGGTTGACGAAGTTGCGGG
AGTCGATTCCGAATCGGCAACACGCAATGGTCTGCTTGAGAATTTAAAAAACTTGCTATCTCAATTGCAT
GATTTGCAAGGCGAATCGCCGTTGATTTTACCGAGCGTCGATGCTCAAGCCGTGGCTTCCGTCGTCGGCG
ATTGGACCGGAATTCCAGTCGGGCGTATGGTCAAGAATGAAATCGAGACCATCATTCATCTGGCCGATGC
CATCGAGCAGCGCATCATCGGACAACGTCATGCGTTGGAAATGATAGCGCGGCGCATACAAACCTCGCGC
GCGGGTCTCGATAATCCGAACAAACCGATCGGGGTGTTCATGCTGGCCGGTACGTCGGGAGTCGGAAAAA
CCGAAACAGCCCTGGCCTTGGCCGAAGCCTTGTACGGCGGCGAGCAGAATGTCATCACAATTAACATGAG
CGAATACCAGGAAGCGCATACCGTGTCGACGTTAAAAGGCGCGCCTCCGGGTTATGTCGGATACGGCGAA
GGCGGTGTGTTGACCGAAGCAGTTCGACGAAGACCCTATTCGGTCGTGCTGCTCGATGAAGTCGAAAAAG
CGCATCCGGACGTTCATGAAATTTTCTTCCAGGTTTTCGATAAGGGCTGGATGGAAGACGGCGAAGGCCG
GGTCATCGACTTCAAAAATACGCTGATTCTTTTGACTACCAATGCCGGTACCGAGCTGATCGCCAATCTC
TGCAAAGATCCGGATTTGATGCCGGAGCCTGAAGGCATTGCCAAAGCCTTGAGGGAACCGTTGCTAAAAG
TCTTTCCGCCGGCATTGTTGGGCCGTCTGGTCGTTATTCCATATTACCCGTTAAGCGACGAAATGATCGC
CGCAATCGCGAAATTGCAGTTAAAACGTATCGAAAAACGTATTGTTGAAAATCATAAGGTACCGTTCAGT
TATGATGAGGATGTTATTAAATTGATAGCCGAACGCTGTACCGAAGTCGAAAGCGGCGGCCGCATGATCG
ATGCGATATTGACCAATACGGTTTTGCCCAGTATCAGCTCCGAGTTTTTAACGCGGATGATGGAAGGTAA
GACAGTTGAAAGGGTGCATGTCGGTGTGGCGGATGGAGAGTTTATTTATGAATTTTGA