SecReT6
Protein ID: 357405297
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1941
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2234948..2236891 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG4T2X4
KEGG IDmah:MEALZ_1941
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-75, Aligned region: 27..329
Phage_base_V [PF04717], Evalue: 3.50E-26, Aligned region: 370..463
DUF2345 [PF10106], Evalue: 0.003, Aligned region: 530..555
DUF2345 [PF10106], Evalue: 0.003, Aligned region: 571..612
Protein Sequence: 647 a.a.     [Download]
>gi|357405297|ref|YP_004917221.1| ImpA family type VI secretion-associated protein [Methylomicrobium alcaliphilum 20Z]
MAQNNRSITADTPLGDDQLVFYRMTGTESIGRLFEFEVELVRDLKLGSVKADQLLGKGMTVKLDLPNGGT
RFFNGEIVQFKHIGLHSRFSCYRATLRPWLWYLTLNADCRIFQDKSVIDVIKAVLDNYAFADVLYKLDGE
YKTLDYCVQYRESDFDFISRLMEHDGIFYYFEHQDGKHKLVITDSNKAFETQSGYRSIPYMPQGNIESRE
RDHIHEWLQENQVTAGKFELNDFDFETPSSDLTIKKHNPGGYSQSGQEVYDFPGKFSSSTVDSKLVDKRL
EERQNAYSIKRGQGNALGLIPGMKFTLSDFYFDEENIEHVVVSASYIIQGDDSVSGMGGGGEIFQCSFDA
IDAKQVFRSLRSTPKPSVSGSQTAIVVGPSGEEIWTDKYGRVKVQFHWDREGQDDENSSCWVRVSQPMAG
KKWGWVSLPRIGQEVVVSFLEGDPDRPLITGRVYNDDQMPPYDLPSNKTQSGIKTRSSKEGTADNFNELR
FEDKKGEEEVYIHAEKDLNCVIENNETRKIGLDKKDKGDQTIEIQNDRTVTLHDGNDKLKIETGNRNIEI
DQGNYDLKVSTGNHSVKIDSGKSTIEAMQSIELKVGGSSIEITQAGITIKGTIIKVEASGTSEIKSPMTV
VKGDGMLILQGGLTKIN
 
Nucleotide Sequence: 1944 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2234948-2236891 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGCACAAAACAATAGATCCATTACTGCCGATACTCCTTTAGGCGATGATCAGCTGGTTTTCTATCGTA
TGACGGGGACAGAATCCATCGGCAGATTGTTCGAGTTTGAGGTTGAGTTAGTTCGCGATCTGAAACTGGG
CAGTGTTAAAGCCGATCAATTGTTGGGCAAGGGAATGACAGTCAAGCTGGATCTGCCCAACGGGGGCACG
CGGTTTTTTAACGGTGAGATCGTGCAGTTCAAGCATATAGGGCTCCATAGTCGCTTTAGTTGTTACCGTG
CAACACTAAGGCCTTGGTTATGGTATTTAACCCTAAATGCCGATTGTCGTATTTTTCAAGATAAATCGGT
TATCGATGTTATTAAGGCAGTATTGGACAACTACGCATTTGCCGATGTTCTTTATAAATTGGACGGCGAA
TACAAAACCTTGGATTATTGCGTTCAATATAGAGAAAGCGATTTCGATTTCATTAGTCGCTTGATGGAAC
ACGACGGCATCTTTTATTACTTCGAGCATCAAGACGGTAAACATAAATTAGTAATTACCGATTCGAATAA
AGCTTTCGAAACTCAAAGCGGCTATCGGTCCATTCCTTATATGCCTCAGGGAAATATCGAGAGCCGTGAG
CGCGATCATATTCACGAGTGGCTTCAAGAGAATCAAGTCACGGCAGGTAAATTCGAATTGAATGATTTCG
ATTTCGAAACGCCAAGCTCCGATTTAACAATCAAAAAACACAACCCGGGGGGGTATTCTCAATCCGGACA
GGAAGTCTACGATTTTCCAGGAAAATTCTCGTCATCAACGGTAGACAGTAAGCTGGTCGATAAGCGCTTA
GAAGAGCGGCAAAATGCCTATTCCATTAAGCGCGGTCAAGGCAATGCTTTGGGCCTCATTCCCGGTATGA
AATTCACACTAAGCGATTTTTATTTTGACGAAGAAAACATCGAACATGTCGTTGTGTCGGCATCCTATAT
TATTCAAGGCGACGATAGCGTTTCAGGTATGGGTGGAGGCGGTGAGATTTTTCAATGCAGTTTCGACGCG
ATCGATGCAAAGCAAGTCTTTCGATCGCTCAGATCGACACCCAAACCTTCGGTTTCAGGGTCGCAGACCG
CGATTGTCGTCGGCCCGTCGGGTGAGGAGATTTGGACCGATAAATACGGTCGCGTCAAGGTCCAGTTTCA
TTGGGACAGGGAAGGACAAGACGATGAAAATAGCTCGTGTTGGGTCAGGGTTTCTCAGCCGATGGCCGGT
AAGAAATGGGGGTGGGTTTCTTTGCCGCGGATCGGTCAAGAAGTCGTCGTCAGTTTTTTAGAGGGCGATC
CGGACCGTCCGTTGATAACCGGGAGAGTTTACAACGACGATCAAATGCCGCCTTATGATTTACCTTCTAA
CAAAACCCAAAGCGGTATCAAGACCCGCAGTTCAAAAGAAGGTACGGCCGATAACTTCAACGAATTACGT
TTCGAGGACAAAAAAGGCGAGGAAGAGGTTTACATCCACGCCGAAAAAGACCTTAATTGTGTAATCGAAA
ATAACGAGACTCGCAAGATCGGTTTAGATAAAAAAGACAAGGGCGATCAAACGATCGAGATCCAAAACGA
TAGAACAGTTACTTTGCACGACGGCAACGATAAGTTGAAAATTGAAACAGGCAATCGTAACATCGAGATC
GATCAGGGGAATTATGACTTGAAGGTATCGACCGGCAATCATTCGGTCAAGATCGATTCCGGCAAAAGCA
CGATTGAAGCGATGCAGTCCATCGAGCTCAAAGTGGGCGGCAGCAGTATCGAAATCACCCAAGCAGGGAT
TACGATCAAAGGAACGATAATAAAAGTGGAGGCCAGTGGGACGTCGGAAATAAAGAGTCCAATGACCGTA
GTCAAAGGAGACGGCATGTTGATTCTGCAGGGCGGCTTGACAAAAATTAACTAG