SecReT6
Protein ID: 357405300
SecReT6 ID512
T6SS typei3
Gene symbol-
Locus tagMEALZ_1944
StrainMethylomicrobium alcaliphilum 20Z
Repliconchromosome [GenBank: NC_016112] [Browse all T6SS(s) in this replicon]
Location [Strand]2238898..2241030 [+]
ProductRhs-family protein
NoteTssI
UniProt IDG4T2X7
KEGG IDmah:MEALZ_1944
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.70E-73, Aligned region: 28..329
Phage_base_V [PF04717], Evalue: 2.50E-25, Aligned region: 370..463
Phage_base_V [PF04717], Evalue: 2.50E-25, Aligned region: 648..662
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 4..9
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 514..537
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 538..561
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 563..585
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 587..601
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 598..617
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 621..633
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 627..643
Gp5_C [PF06715], Evalue: 1.40E-10, Aligned region: 646..655
Protein Sequence: 710 a.a.     [Download]
>gi|357405300|ref|YP_004917224.1| Rhs-family protein [Methylomicrobium alcaliphilum 20Z]
MAQNNRSVTAETPLGDDQLIFYRLTGKEEIGRLFEFDVELIRDQKLGGVKADRLLGKGMTVNLDLPNGTT
RHINGEIVQFKHTGLRGRYITYLATLRPWLWYLTLNADCRIFQDKSVIDVIKEVFSRYSFADVQYKLEGD
YQPLDYCVQYRESDFDFISRLMEHEGIFYFFEHDNGKHTLVIADSNKAFQIRSGYETIPYFPLGNTDSRQ
RDHIYEWLQENQVTTGKYELNDFDFESPSSDLTIKKHNPGGYSHSDQEIYDFPGKFTVSSVNTKLVDKRL
EERQNAYSLKRGQGNASALIPGMKFSLADFYFSEENKEHIVVSASYAIQGDDLESSMSGAGEIFQCTFAA
IDAAQAFRPERLTRKPIVSGSQTAIVVGPSGEEIWTDKYGRVKVQFHWDREGQDDENSSCWVRVSHPMAG
KKWGWISLPRIGQEVVVSFLEGDPDRPLITGRVYNDEQMPPYELPTNKTQSGIKTRSSKAGTADNFNEIR
FEDKKGSEQLFIHAEKNQDIEVENNETHWVGNDRSKNIDHDETTVVGHDRTETVGNNETITIGVNRTETV
GSNESITVGSNRTRNVGQNEVVNVGLTRTHNVGVNEMINVGAAQEVTVGGAQAVTIGLTQAVTVGKDVNE
TVGNNRRASIGKDNSLSVGKNLTIDAGDQVVIKTGKASITMKKDGTITIQGKNITIKGSGEINAKADKNV
VIKGKKILQN
 
Nucleotide Sequence: 2133 bp     [Download]
>gi|357403388|ref|NC_016112.1|:2238898-2241030 Methylomicrobium alcaliphilum chromosome, complete genome
ATGGCCCAAAACAATCGATCCGTGACAGCCGAGACTCCGCTCGGAGACGATCAGCTCATCTTCTACCGGT
TGACAGGTAAGGAAGAAATCGGCCGATTGTTCGAATTCGACGTCGAGCTGATTCGCGATCAAAAACTGGG
AGGCGTCAAGGCCGATCGATTGCTCGGCAAGGGCATGACCGTCAATCTCGATCTGCCGAACGGAACGACG
CGTCATATCAACGGCGAGATCGTGCAATTCAAACATACCGGCCTGCGCGGACGTTATATTACCTATCTAG
CTACGTTGAGGCCTTGGCTATGGTATTTGACGTTGAATGCCGATTGCCGAATATTCCAGGATAAATCGGT
CATCGATGTCATCAAGGAAGTCTTCAGTCGCTACTCCTTCGCCGACGTTCAATACAAACTGGAAGGCGAC
TATCAGCCCTTGGATTATTGCGTGCAATACCGCGAAAGCGATTTCGATTTCATCAGCCGCCTGATGGAGC
ACGAAGGCATCTTTTATTTCTTCGAGCATGACAATGGCAAACATACTTTGGTCATCGCCGATTCGAACAA
AGCATTTCAGATTCGGAGCGGTTATGAGACCATTCCTTATTTTCCGCTCGGCAACACAGACAGCCGCCAA
CGCGATCATATTTACGAATGGCTCCAGGAAAATCAGGTAACGACAGGAAAATACGAACTCAACGATTTCG
ATTTCGAATCGCCCAGTTCCGATTTGACGATCAAGAAGCACAATCCCGGCGGCTATTCGCATAGCGATCA
AGAGATCTATGACTTTCCGGGAAAATTTACCGTATCATCGGTCAATACCAAGCTGGTCGATAAGCGACTG
GAAGAGCGGCAAAATGCTTATTCGTTGAAACGCGGCCAAGGTAATGCTTCGGCGTTGATTCCCGGTATGA
AGTTTTCGCTCGCGGATTTCTATTTCTCGGAAGAAAACAAGGAGCACATTGTCGTATCGGCTTCTTATGC
GATTCAAGGCGACGATCTTGAATCGAGCATGAGTGGAGCGGGTGAGATATTCCAGTGTACTTTTGCCGCG
ATCGATGCTGCTCAGGCTTTTCGTCCGGAAAGACTCACTCGGAAGCCGATCGTTTCCGGCTCTCAGACTG
CGATTGTCGTGGGTCCGTCAGGCGAAGAGATTTGGACCGACAAATACGGCCGCGTCAAGGTACAGTTTCA
TTGGGATAGGGAAGGGCAAGACGATGAAAACAGCTCGTGTTGGGTCAGGGTTTCTCATCCGATGGCCGGT
AAGAAATGGGGTTGGATATCGTTGCCGCGCATCGGCCAAGAAGTGGTCGTCAGTTTCCTGGAAGGCGATC
CGGATCGGCCTCTGATCACCGGACGAGTCTATAACGACGAGCAAATGCCGCCTTATGAGTTGCCAACCAA
TAAAACGCAAAGCGGTATCAAGACCCGCAGTAGTAAGGCAGGTACTGCTGATAATTTTAATGAAATCCGT
TTCGAGGACAAGAAAGGCTCCGAACAGCTTTTCATCCATGCTGAAAAAAATCAAGACATCGAAGTCGAAA
ACAACGAGACACACTGGGTAGGCAACGACCGCAGTAAAAACATCGATCATGATGAAACAACCGTCGTCGG
GCACGACCGAACCGAGACGGTCGGCAATAATGAGACGATCACAATCGGCGTCAATCGCACCGAAACGGTC
GGTTCTAACGAGTCGATCACGGTCGGCTCGAACAGAACCCGCAATGTCGGCCAGAACGAAGTCGTCAATG
TCGGATTGACCCGTACCCACAATGTCGGCGTCAACGAAATGATCAACGTCGGTGCCGCTCAGGAAGTCAC
GGTAGGCGGCGCGCAAGCCGTCACGATCGGATTGACTCAGGCCGTGACGGTCGGCAAAGACGTGAATGAA
ACGGTAGGCAACAATCGCAGAGCCAGCATTGGTAAGGACAATTCGCTCAGCGTCGGCAAGAATCTAACGA
TCGACGCCGGGGATCAGGTCGTGATCAAAACCGGCAAGGCCAGCATCACGATGAAAAAAGACGGCACGAT
CACGATTCAGGGCAAGAACATTACGATAAAAGGCAGCGGCGAAATCAATGCGAAGGCCGACAAAAATGTC
GTAATCAAAGGTAAAAAAATCCTGCAAAATTAA