SecReT6
Protein ID: 360038111
SecReT6 ID513
T6SS typei1
Gene symbol-
Locus tagVch1786_II0901
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]889678..890184 [+]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDG7TVU9
KEGG IDvce:Vch1786_II0901
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-58, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|360038111|ref|YP_004939873.1| type VI secretion system protein ImpB [Vibrio cholerae O1 str. 2010EL-1786]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKNNFEAVMRESE
LKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERL
QSLLNSEESREKLLAELNLLSGQEEPQA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|360037214|ref|NC_016446.1|:889678-890184 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGTCTAAAGAAGGAAGTGTAGCTCCCAAAGAGCGGATTAATATCAAGTATATTCCGGCGACGGGGGATG
CACAGGCTGAGGTTGAGCTACCACTCAAAACCCTAGTTGTAGGTGATTTCAAAGGGCATGCGGAGCAAAC
CCCATTGGAAGAGCGTGCAACAGTCACGGTAGATAAGAACAACTTTGAAGCCGTAATGCGCGAGAGCGAG
CTGAAAATCACCGCCACGGTGAAAAACAAGCTGACTGATGATGAGAATGCCGAGCTTCCTGTTGAACTCA
ATTTCAAATCCTTAGCCGACTTCGCTCCTGATGCGGTGGCATCACAAGTTCCAGAACTGAAAAAATTGAT
TGAGTTGCGTGAAGCGTTAGTTGCCCTTAAAGGGCCGCTAGGCAACATTCCCGCATTTCGTGAGCGTTTA
CAGTCATTACTCAACTCAGAAGAGTCGAGAGAAAAGCTGTTGGCAGAACTGAATCTGCTCAGTGGTCAAG
AAGAGCCACAAGCGTAA