SecReT6
Protein ID: 360038113
SecReT6 ID513
T6SS typei1
Gene symbol-
Locus tagVch1786_II0903
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]891706..892143 [+]
Producttype VI secretion system protein
NoteTssE
UniProt IDG7TVV1
KEGG IDvce:Vch1786_II0903
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.00E-20, Aligned region: 37..127
Protein Sequence: 145 a.a.     [Download]
>gi|360038113|ref|YP_004939875.1| type VI secretion system protein [Vibrio cholerae O1 str. 2010EL-1786]
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDA
TLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITATINSEALHEKVQFSLLLDQSR
KYRVF
 
Nucleotide Sequence: 438 bp     [Download]
>gi|360037214|ref|NC_016446.1|:891706-892143 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGACGTACATCGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTTTTCGAACGTTTGGAAGCCAACGCCA
AACCTATGTCGCTGACCCGTGGGCCAGACGCGTGGGATGTACTCGAATCGATCAAACGGAATGTCTCTAA
CATTCTGAACACTCGAATTGGTGGAGCGCAAAGTGCCCCTCATCTCGGGTTGGTGGATTTTAATGATGCA
ACGCTGGAAACCTTAGATCTCTCCGTGCGAATTAAATTGGCGATTCAACAGTGCCTTGAGCGCTATGAGC
CGCGTTTAACTCGCGTTCTGGTGAGAGCGGATCAAGATAGCTTTAACCCGCTGACTTTAAGGTTCCACAT
TACCGCGACCATCAATAGCGAAGCGTTACACGAAAAAGTCCAGTTCAGTCTGTTATTGGATCAAAGCAGA
AAATATCGAGTGTTTTAA