SecReT6
Protein ID: 360038115
SecReT6 ID513
T6SS typei1
Gene symbol-
Locus tagVch1786_II0905
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]893882..894898 [+]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDG7TVV3
KEGG IDvce:Vch1786_II0905
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-93, Aligned region: 27..325
Protein Sequence: 338 a.a.     [Download]
>gi|360038115|ref|YP_004939877.1| type VI secretion system protein ImpH [Vibrio cholerae O1 str. 2010EL-1786]
MGHTERNAAVDLNSDPAQASPLSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLVFSANPSLGFS
PSDVMALEARDDERWVMLTNFFGLSGAQSPLPGFILEQLVTEEPGGYKQPFLDFFNNRLINLVYRVWRKY
RYYVRFQPGAQDVFSAQLFALVGLGDPDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLPDV
SIRQWVRRRVSIDRSQQLALGKQNARLGMDTVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLC
KLVEFILREQMAYDLELAMDEREAPLFCLDTRQNIALGWTSFLGQDAANKHVLIQVRQ
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|360037214|ref|NC_016446.1|:893882-894898 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGGGGCACACAGAGCGGAATGCAGCCGTTGATCTGAATTCAGATCCAGCGCAAGCCTCTCCGTTGAGCT
TGCCGGGCAATGTACGGGAATACAACTTCTACCAACTGGTTGAGCTGTTGCAAAAACTGGCTGATATCAA
TCCCGAATCGGAAGAGTGGGAGCGCGATTGCCGCTTGGTGTTCAGTGCTAACCCGAGCCTTGGATTTTCG
CCCAGTGATGTGATGGCGCTTGAAGCGCGTGACGATGAGCGTTGGGTTATGTTGACCAACTTTTTTGGCC
TTTCCGGTGCACAGTCACCTCTGCCGGGGTTCATCCTTGAGCAATTGGTGACGGAAGAGCCTGGGGGATA
TAAGCAGCCGTTTCTCGATTTTTTCAATAACCGATTGATTAATTTGGTTTATCGCGTTTGGCGTAAATAC
CGTTACTACGTACGTTTTCAGCCCGGTGCGCAGGATGTGTTCTCTGCACAGCTGTTTGCGCTGGTGGGGT
TGGGCGATCCTGACCTTCGCGGTGAAACGCCGATCAACTGGTGCAAAATGCTGGCTTACGCGGGCACGCT
GGCCGGACGTAGCCGTTCGCCACAAGTTGTGGCCGGCATTATTGCTCACTGTTTTGATTTACCGGATGTC
TCCATTCGCCAGTGGGTCAGACGTCGGGTATCGATTGATCGGAGTCAGCAACTGGCGCTGGGCAAGCAGA
ATGCGCGGTTGGGGATGGACACGGTGATTGGCGAGTCCGTTATTGATTGCAGTGGAAAATTTATTATCTG
TATCAAACGGTTATCTCGCAGTCGTTTTGCTGATTTTTTGCCCTCCGGTAAAGAGTATCAGCCACTTTGC
AAGCTGGTGGAGTTTATTTTGCGCGAACAGATGGCGTATGACCTCGAGCTGGCGATGGATGAACGAGAAG
CGCCGCTGTTTTGTCTGGATACTAGACAGAATATCGCCCTCGGCTGGACTTCGTTTCTTGGCCAAGATGC
AGCCAATAAACATGTGTTAATTCAAGTAAGGCAATAA