SecReT6
Protein ID: 360038116
SecReT6 ID513
T6SS typei1
Gene symbol-
Locus tagVch1786_II0906
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]894901..896388 [+]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDG7TVV4
KEGG IDvce:Vch1786_II0906
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-06, Aligned region: 35..102
Protein Sequence: 495 a.a.     [Download]
>gi|360038116|ref|YP_004939878.1| type VI secretion system protein ImpI [Vibrio cholerae O1 str. 2010EL-1786]
MNSVTLPSLTLLVTNAQHLESGLSAQHTWTSSGGVIGSSPNAQWRLVDAQGSVKPMHCEVMMVDGAYCLK
DSCGSTYVNGADMPLGVGQMARLTHKDEVSVGPYRLRVLFGNAIEVEEQYGSLDALFASKDEDLLADLTL
DIEPEKHELPTNTDPLQALDNLMGAAGSSTSLLDDPKSEQPLSAQPSLVPQDNLVLQNADFTPQADSEYE
MTSSIRLKKILGFAKATFAKQTKSEAPNVTSATPTISQYKTSESNVSEGFTMDEKVLDLLEEEVAKSFQP
QLEKSAYSTMHTSSTSQANHLVTGPILEGLGVDLSDENDMNRMHLLSQELGESLQACVRGLLDLHQQVSE
SRFGTLNRNLQPIEDNPLRLGLSYEETIRTLYDADKSVVHLSAPAAIAESLKTVRDHNEAMQFATSEALS
QILNAFSPQVMLRRFHHYKRNSDTTQTSTDAWAWNMYCSYYQELTSNRQRGFEKLFWEIFEQAYDRKIRE
KQLEL
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|360037214|ref|NC_016446.1|:894901-896388 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGAACTCAGTGACATTACCTTCGTTGACCCTATTAGTCACCAATGCTCAGCACTTAGAGTCTGGCTTGT
CCGCTCAGCATACGTGGACCTCGTCAGGTGGGGTGATCGGCTCATCGCCGAATGCGCAGTGGCGTTTGGT
CGATGCGCAAGGCAGTGTAAAACCCATGCACTGTGAAGTGATGATGGTAGACGGGGCGTATTGTTTAAAA
GACAGCTGCGGCAGCACGTATGTCAACGGGGCAGACATGCCACTGGGCGTTGGGCAAATGGCACGTCTGA
CTCACAAAGATGAAGTGAGTGTGGGGCCTTACCGTTTGCGAGTGCTGTTTGGTAACGCCATCGAAGTGGA
AGAACAATATGGATCTTTAGATGCGCTGTTTGCCTCTAAGGATGAGGATCTGCTAGCGGATTTGACGCTC
GACATCGAACCAGAAAAACACGAATTACCAACCAATACAGACCCATTACAGGCGCTCGATAACCTGATGG
GTGCGGCGGGCAGTTCGACCTCCTTACTGGATGATCCTAAAAGTGAGCAGCCGTTATCCGCCCAACCTAG
CCTCGTGCCACAAGATAACTTAGTGCTGCAAAATGCCGATTTTACGCCACAAGCGGACAGTGAGTATGAG
ATGACCTCATCGATCCGCCTTAAGAAAATTCTTGGTTTTGCGAAGGCCACCTTTGCTAAGCAAACCAAAT
CAGAAGCACCGAACGTGACTTCTGCCACCCCCACAATTTCTCAATATAAAACCAGCGAAAGCAACGTATC
AGAGGGCTTCACAATGGATGAAAAAGTACTGGATTTGTTAGAAGAGGAAGTCGCGAAAAGTTTCCAACCG
CAGTTGGAGAAAAGCGCGTATTCCACTATGCACACAAGCTCAACCAGCCAAGCTAACCACTTGGTGACAG
GTCCGATCTTGGAAGGGCTCGGCGTAGATCTGAGCGATGAAAATGATATGAATCGTATGCATCTTTTATC
GCAAGAGTTGGGTGAGTCTTTGCAAGCTTGTGTGCGCGGTTTACTCGATTTGCATCAACAAGTGAGTGAA
AGCCGTTTCGGTACTTTGAACCGTAATCTGCAACCCATTGAAGATAACCCGCTGCGTTTAGGTCTCTCCT
ATGAAGAGACGATCCGCACTCTGTACGATGCCGACAAGAGCGTCGTGCACCTTTCTGCCCCTGCGGCGAT
TGCTGAAAGCCTAAAAACCGTTCGCGATCATAATGAAGCGATGCAGTTCGCCACGTCAGAAGCCTTGAGC
CAAATTCTCAACGCTTTCTCACCACAGGTGATGCTGCGCCGTTTCCACCACTACAAGCGCAATTCTGATA
CCACACAAACTTCAACGGATGCTTGGGCGTGGAATATGTACTGCAGCTACTACCAAGAGCTGACCTCTAA
CCGCCAACGCGGCTTTGAGAAGTTGTTCTGGGAGATCTTTGAGCAAGCCTACGATCGCAAAATTCGCGAG
AAGCAACTGGAGCTATAA