SecReT6
Protein ID: 360038117
SecReT6 ID513
T6SS typei1
Gene symbol-
Locus tagVch1786_II0907
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]896391..896867 [+]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDG7TVV5
KEGG IDvce:Vch1786_II0907
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 12..148
Protein Sequence: 158 a.a.     [Download]
>gi|360038117|ref|YP_004939879.1| type VI secretion system protein VasD [Vibrio cholerae O1 str. 2010EL-1786]
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFELKDDSMFMSSD
YDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHFAEPELSEWKKAVKVINKGRE
YHLLMLFKDYDVKLDRVE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|360037214|ref|NC_016446.1|:896391-896867 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
GTGAACAAAGTGCTGTGGATGCTGTTTGCCTTGACGGTACTGACCGCGTGCAGTTCGTCGGATAAGTACG
AGCCTGCGAAAGAGCCGACCAAGGTGACTTTTAGCTTAGTCAGCGATGAAGGGGTGAACCCGAACATCTG
GGGTGAAGCGTCACCGATAGAAATTCAAGTTTTTGAGCTAAAGGATGACTCGATGTTTATGTCGTCCGAC
TACGACCAGATCAAAACCGATTATAAAAAAGCGCTGCGCAGTAACTTTGTTAAAAACTACGACTATGTAC
TGACTCCAGGGCAGTTCAAATTCGTCAACGCTTTCGAAGTCGATGAGGAGACCAACTACATCGGCGTGAT
GGCTCATTTTGCCGAGCCTGAACTCAGCGAATGGAAGAAAGCGGTCAAGGTGATCAATAAAGGGCGAGAG
TATCACTTGCTGATGCTGTTTAAAGACTACGATGTGAAATTGGATAGGGTGGAATAA