SecReT6
Protein ID: 360038118
SecReT6 ID513
T6SS typei1
Gene symbol-
Locus tagVch1786_II0908
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]896874..898208 [+]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDG7TVV6
KEGG IDvce:Vch1786_II0908
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-161, Aligned region: 19..443
GMP_synt_C [PF00958], Evalue: 0.00014, Aligned region: 63..139
GMP_synt_C [PF00958], Evalue: 0.00014, Aligned region: 302..374
Protein Sequence: 444 a.a.     [Download]
>gi|360038118|ref|YP_004939880.1| type VI secretion system protein ImpJ [Vibrio cholerae O1 str. 2010EL-1786]
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRIAIERAVGVMP
DGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERGTGRYVSRRLEVRDVHSVQGD
TTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSVVLDPDFIPCHLNVVGISALHRFINEMSGLM
RERAKNIAQRISSPAQGGVADVSDFMLLQALNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDES
RLPPSLPSYNHDSPSHSFQPLIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVK
ARMPLDELRRLFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTH
SSGFAFHVAAAFDDLELQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|360037214|ref|NC_016446.1|:896874-898208 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGTTTGCGCGTAACCGAGTGATCTGGAATGAAGGGCTATTTATTAAGCCGCAACATTTCCAGCAACAGC
AGAGATATACGGAGTACTGCCTAGACGAGCGCCTGAGCACCGTGAGCCGTTACTTGTATGGGATTTCCGA
GTTGTCGCTCAACCCGGAATACCTCTCGTTTGGCCGTATTGCGATTGAGCGTGCGGTCGGCGTGATGCCC
GATGGCACCACCTTTCGTATTCCTCAAGAAGATCATCTTCCCGATGCGCTCGAAGTGACCGATGCGTCAT
TGGCAAACCAGATTGTCTACTTAGCCGTACCGCTACGTAGTGAGTCGCTGATGGAGATTAACTGGCCAGA
AGAGCGTGGTACGGGGCGCTATGTCAGCCGTCGTCTCGAAGTGCGTGATGTCCATAGCGTGCAGGGTGAT
ACCACGACGATTGATGTTTCCCCTGTGCGTTTGCAACTCATGCTTGAGCGAGAGGATCGCAGTGCGTATG
CCTCAATTGCTATTGGCCGTATTTTAGAAAAACGTCCTGATGGCAGCGTGGTGCTCGATCCGGATTTCAT
CCCTTGTCACTTGAATGTAGTGGGCATCTCTGCGCTGCACCGCTTTATTAATGAGATGTCAGGCCTGATG
CGTGAGCGAGCGAAAAATATTGCTCAGCGCATCAGCTCTCCAGCACAAGGTGGGGTTGCTGATGTTTCGG
ACTTTATGCTGCTGCAAGCTTTAAACCGTCTGCAACCACAAATGAAGCATTTGGCAGAGCTGCGCAGCTT
ACACCCAGAGCGTCTGTTTGAATGTCTCTCGTGTGTGTGTGGTGAGCTGGCTACCTTTACTGACGAAAGT
CGTCTGCCGCCCAGTTTGCCAAGCTATAACCATGATTCACCCAGCCACTCTTTCCAGCCGCTGATCCGCA
GCTTGCGTCAGAGCTTGAGCGTGGTGCTAGAGCCGCGTGCCGTCTCTATCCAACTGGATAAACGTAAGTA
CGGTTTGATGGTTGCGCCAATCCATGATCCGCAACTGATGGAGAGTGCAGAGTTTATCATCGCGGTTAAA
GCTCGCATGCCGTTGGATGAGCTACGCCGTCTGTTTACTCAGCAAACCAAAGTGGCATCGGTTGAGAAAA
TTCGTGAACTCATCTCACTGCAACTGCCGGGTATTCCATTGACGCCATTACCCGTCGCACCGCGCCAATT
GCCTTACCACGCTGGCTACACCTACTACCAACTGGATAAAACCAGCGCTGCATGGGCGATGTTGACTCAT
TCCAGCGGTTTTGCGTTCCACGTTGCTGCAGCTTTTGACGATCTTGAGCTGCAATTCTGGGCTATCAGGA
GCTAA