SecReT6
Protein ID: 360038122
SecReT6 ID513
T6SS typei1
Gene symbol-
Locus tagVch1786_II0912
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]903211..903867 [+]
Producttype VI secretion system protein VasI
NoteVCA0118
UniProt IDG7TVW0
KEGG IDvce:Vch1786_II0912
PDB IDNA
Domain hit(s) vs Pfam DUF3121 [PF11319], Evalue: 4.60E-59, Aligned region: 32..212
Protein Sequence: 218 a.a.     [Download]
>gi|360038122|ref|YP_004939884.1| type VI secretion system protein VasI [Vibrio cholerae O1 str. 2010EL-1786]
MRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQVAIAPSNPYP
AEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSRIELALPKEV
ADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFDTRGVNEALD
ALRERCGW
 
Nucleotide Sequence: 657 bp     [Download]
>gi|360037214|ref|NC_016446.1|:903211-903867 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGAGAATTACCGTTTTAGTGGTCAGTTTGATCTTGGGTTGCGCGGGCTCTGCGCATGTTTTAGCAGCAT
CGCAAGATGCGGGCTCACAGGTTGAGCAAGCTGAGCTGTGCCGCGAAATTCCTGCGCGTTTAGAGCGTTT
GGCTTGTTTTGACCGTGTCTTTGCCACGCCCCTTGAGCAAGTGGCTATCGCACCGTCCAATCCTTATCCC
GCAGAGTGGCAACGCGCCATGGCGGCATTGTCTGAGTCGCAGTCCGAAGCGGGTTGGGTATTAGGTACGC
AAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCCTGCGCAAAATCGCAGCTCAGGGGAAACATC
TCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGCATTGAGCTGGCTTTACCGAAAGAAGTG
GCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGTTCTGGCGCAGTGACGATCACGGCGTAC
TGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAAATTGGCCGCCAGTGAGTCTCGCCTGTT
GCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGATACTCGAGGTGTCAATGAAGCCCTTGAT
GCTTTGCGCGAACGCTGTGGTTGGTAA