SecReT6
Protein ID: 360038127
SecReT6 ID513
T6SS typei1
Gene symbol-
Locus tagVch1786_II0917
StrainVibrio cholerae O1 str. 2010EL-1786
Repliconchromosome II [GenBank: NC_016446] [Browse all T6SS(s) in this replicon]
Location [Strand]913463..913831 [+]
Producthypothetical protein
NoteTsiV3 (i)
UniProt IDG7TVW5
KEGG IDvce:Vch1786_II0917
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 122 a.a.     [Download]
>gi|360038127|ref|YP_004939889.1| hypothetical protein Vch1786_II0917 [Vibrio cholerae O1 str. 2010EL-1786]
MNNLLSAYVTMLLILLSISGGAIASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDF
YSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
 
Nucleotide Sequence: 369 bp     [Download]
>gi|360037214|ref|NC_016446.1|:913463-913831 Vibrio cholerae O1 str. 2010EL-1786 chromosome 2, complete sequence
ATGAATAACTTGCTTTCTGCGTATGTAACTATGCTGTTGATATTATTAAGTATTAGTGGTGGCGCTATTG
CTAGTGAAAACTGCAATGATACATCTGGAGTGCATCAAAAAATTCTAGTGTGTATCCAAAATGAGATAGC
TAAGTCAGAGACTCAGATTAGAAATAATATTTCTTCTAAGTCTATAGATTATGGCTTTCCTGATGATTTC
TACAGCAAGCAAAGATTAGCTATTCATGAAAAGTGTATGCTTTATATAAATGTCGGTGGCCAACGTGGTG
AATTGCTAATGAACCAATGTGAACTTTCGATGCTACAAGGCCTTGATATTTACATTCAACAGTATATAGA
GGATGTTGATAATAGTTAG