SecReT6
Protein ID: 365960973
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09690
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2273880..2276744 [-]
Producthypothetical protein
NoteTagL
UniProt IDG8XBG7
KEGG IDfco:FCOL_09690
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.10E-19, Aligned region: 312..407
OmpA [PF00691], Evalue: 1.10E-19, Aligned region: 781..801
Protein Sequence: 954 a.a.     [Download]
>gi|365960973|ref|YP_004942540.1| hypothetical protein FCOL_09690 [Flavobacterium columnare ATCC 49512]
MAGGIKKIHYAKGPIFKEKSIPNEMVVIAPDDFILFSIEWLETTLEKEKQRNVVWIWQEDNRKTILKKTV
LNSAMLYGIKIPKKLCGFTYFLEASLSGNRNYSKKNYTGLYIRGYCPPRITASKWAVSSDGTPAGKQKQF
AYGERVYLNLDTEGINGYKNLTIELYAHKTLAPDPLTRTIVGVDVTDGEINLEINNTLIWYGKHLFPKEV
MEFYVKVKLPNGKYIEDYNGDIIHARYLRIKPQQVFQMPEPPKNSTALKVGNNKTSLKNYHPCKLNKVQL
TETGEPFYIFEEGKTLLKKEHATLKRVSQIVYFDYDQYHLRDDARKTLDILLDFLLYNPFLNMMLEGHAD
DRGNLDYNQSLSEKRANNVKNYLVQKGLKDERIKTRGFGEARNAIKATNETQHSKNRRTVIEFNYNEYDS
NAIVYQTLAGSVLKPKNITLTLIDHDTVKCLRKHDPHQKEIQIQNNKEKILIKDSQADIKVKSSVPPHFA
SSYLFYLIEYLAPGVSLNHSYYINFHTCAYFADKTYPSLQMLVYPDLVWIANLQYNFEGKGDYFFHNKKV
ELEQGIKAVLDEFRNSLVGKIMSYLPTGFAQDLLFDYIEKQAEDYQYGAHVIHDRDIEKAGEVLVLKGTE
VNLITQTKYTKYAAAYAIYVMVLLTIVIEIIIIYLTRGRNLTGKAKKIQKVLRKIKALEKIVERKGDVDI
EIIPPSIAINAGMYYKQLANRNMAMFYEVNVKADPIVAVEIKKEFDLLDLLDKGIDIAKAKTPNDPQVQE
QLKQNAPNNSKIKQYLNNAGLKVNGEIVVTGEIGFEHNVIVNTLTGEFTILDQLGNGFVNKNEVLLKPQI
KFDAKFKGEYKKDFDFEILQAEIEAKLDVELYGAIGLKIGYGYQKEKGLFLNQKLYFTGIKGIYKGSFKL
TSKKLGKLERETNDGKPTPFTLLEPFEMELMTIQLFNHNKNNKR
 
Nucleotide Sequence: 2865 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2276744-2273880 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGGCAGGAGGAATAAAAAAAATACATTACGCTAAAGGGCCCATTTTTAAAGAAAAATCAATTCCAAACG
AAATGGTAGTTATTGCCCCTGATGATTTTATCTTATTTTCTATAGAATGGTTAGAAACAACCTTAGAAAA
AGAAAAACAAAGAAATGTCGTTTGGATATGGCAAGAAGACAATAGAAAAACCATTCTAAAAAAAACCGTC
CTTAATAGTGCTATGCTCTACGGTATCAAAATACCCAAGAAGCTGTGCGGATTTACTTATTTTCTTGAAG
CCAGTTTATCAGGTAATAGGAACTATTCTAAAAAAAATTACACAGGTCTTTACATCAGAGGATACTGCCC
CCCTCGTATAACTGCCAGTAAATGGGCTGTAAGTAGCGATGGTACTCCAGCAGGCAAACAAAAACAATTT
GCTTATGGCGAACGAGTGTACCTAAATTTAGATACAGAAGGTATAAACGGTTACAAAAATCTTACGATAG
AACTATATGCTCATAAAACACTTGCCCCTGACCCCTTGACAAGAACCATTGTAGGTGTTGATGTAACAGA
TGGCGAAATAAACCTTGAAATAAACAATACTCTTATATGGTATGGCAAACATTTGTTTCCCAAAGAAGTC
ATGGAATTTTATGTAAAAGTAAAATTGCCAAATGGCAAGTACATAGAAGATTATAACGGCGATATTATAC
ATGCCCGATACCTACGTATAAAACCCCAACAGGTTTTTCAAATGCCTGAACCCCCTAAAAACAGCACCGC
TCTAAAAGTAGGAAATAATAAAACCAGTCTAAAAAACTACCACCCTTGCAAACTAAACAAAGTACAACTT
ACAGAAACAGGAGAACCCTTTTATATTTTTGAAGAAGGCAAAACCCTATTAAAAAAAGAACATGCTACCT
TAAAAAGAGTATCCCAAATTGTATACTTTGATTATGATCAGTATCATTTGCGAGACGATGCTAGAAAAAC
ACTAGACATACTCCTAGATTTCTTGCTTTACAACCCTTTTTTAAACATGATGCTAGAGGGGCACGCAGAC
GATAGAGGAAACCTAGACTACAACCAATCCCTATCCGAAAAAAGAGCCAATAACGTAAAAAACTATTTGG
TACAAAAAGGATTAAAAGATGAACGGATAAAAACACGCGGATTTGGCGAAGCACGCAACGCTATAAAAGC
CACTAACGAAACTCAACACTCTAAAAACCGCCGTACCGTTATAGAATTTAATTACAACGAATACGATAGC
AATGCCATAGTTTATCAAACCCTAGCAGGAAGCGTATTAAAACCCAAAAACATAACGCTAACCCTAATAG
ACCATGACACGGTAAAATGTCTGCGTAAGCACGACCCTCATCAAAAAGAAATACAAATACAGAATAATAA
AGAAAAAATTCTAATAAAAGACAGTCAAGCCGATATAAAAGTAAAAAGCTCTGTCCCTCCCCATTTTGCC
TCTTCCTATTTATTTTATCTAATAGAATATTTAGCCCCTGGTGTTTCTCTAAATCATTCATACTATATTA
ACTTTCATACCTGCGCCTATTTTGCAGATAAGACTTACCCTAGTTTGCAAATGCTCGTGTATCCTGATCT
AGTTTGGATAGCGAACTTGCAATATAATTTTGAGGGTAAAGGCGATTACTTTTTTCACAATAAAAAGGTA
GAATTAGAGCAGGGAATAAAAGCAGTTTTAGACGAATTTAGAAACTCGTTAGTAGGTAAAATAATGAGTT
ATTTACCCACGGGATTTGCGCAAGATTTATTATTTGATTACATAGAAAAACAAGCCGAAGATTATCAATA
TGGTGCACACGTTATACACGACCGTGATATAGAAAAAGCGGGTGAAGTATTAGTATTAAAAGGCACGGAA
GTAAACTTAATTACACAAACAAAATATACCAAGTATGCTGCTGCTTATGCTATTTATGTAATGGTTTTAC
TTACTATTGTTATAGAAATTATCATTATTTACTTAACTAGAGGTAGAAACCTAACAGGTAAAGCAAAGAA
GATTCAAAAGGTTTTACGCAAAATAAAAGCCCTTGAAAAAATAGTAGAACGTAAAGGCGATGTAGATATA
GAAATTATCCCACCTAGTATTGCCATAAATGCAGGGATGTACTACAAACAATTAGCCAACCGAAATATGG
CAATGTTTTATGAAGTCAATGTAAAAGCAGACCCGATAGTAGCCGTTGAGATAAAAAAAGAATTTGATTT
ACTTGATTTACTTGATAAAGGGATAGATATAGCCAAAGCCAAAACCCCTAACGACCCACAAGTACAAGAA
CAGTTAAAGCAAAACGCGCCTAATAATTCAAAAATCAAACAATATCTTAATAACGCAGGACTAAAAGTAA
ATGGTGAAATTGTCGTTACAGGCGAAATAGGTTTTGAGCATAATGTTATTGTAAATACCCTTACAGGAGA
ATTTACTATCTTAGACCAGTTAGGTAACGGTTTTGTAAATAAAAATGAAGTATTATTGAAACCCCAGATT
AAGTTTGATGCGAAATTTAAAGGAGAATATAAAAAAGATTTTGATTTTGAAATTTTACAAGCAGAAATCG
AAGCTAAATTAGATGTTGAATTATATGGTGCGATAGGGTTGAAAATTGGATATGGATATCAAAAAGAAAA
AGGTCTTTTTTTGAATCAAAAATTATATTTCACCGGAATTAAAGGCATATACAAGGGAAGTTTTAAATTG
ACTTCTAAAAAGTTAGGAAAATTAGAACGAGAAACAAATGATGGAAAACCTACACCTTTTACACTTTTAG
AACCTTTTGAAATGGAGTTGATGACAATACAACTATTTAATCATAATAAAAACAACAAGCGATGA