SecReT6
Protein ID: 365960976
SecReT6 ID922
T6SS typeiii
Gene symbol-
Locus tagFCOL_09705
StrainFlavobacterium columnare ATCC 49512
Repliconchromosome [GenBank: NC_016510] [Browse all T6SS(s) in this replicon]
Location [Strand]2278454..2280280 [-]
Producthypothetical protein
NoteTssF
UniProt IDG8XBH0
KEGG IDfco:FCOL_09705
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 0.0024, Aligned region: 23..101
DUF879 [PF05947], Evalue: 0.0024, Aligned region: 299..317
Protein Sequence: 608 a.a.     [Download]
>gi|365960976|ref|YP_004942543.1| hypothetical protein FCOL_09705 [Flavobacterium columnare ATCC 49512]
MNQERIKDRILRKASRLWGFNELQTESSFDPIIGLLLTACASELEKLNTDLEDSRSRIIERVLDLMFPEE
VSGVTPSSAVVQLFPTENNVKISKYNQFKGTKKITNIYNPTEVLHKDVFFGPTIETTLTTAKVEYLAYGN
SLKKIDNFFFNDIISTSNNFIPKGELWIGLKCSDTENIINPTFYININNSYQKDLFFYYLRQAKIYFGNQ
EFTFNEGYNAAEENFNFENIVSKNYSNLDQINNRVNSFYLPNFFTLSGTINHAEKTDSDTLFQHYFLDHK
LEDDKSIIWLRVELTETIGNDVLENVSVNLNCLPVVNKRISRASHRVTGALNIVPIDSDEFFLDLDYVSN
DEGYRYDLRNYNDNKSGTVTLRHGGVSRFDQRRASDLLQQLLELIKDETASFMSIGNDATRETLKQINQN
VAALYQLSKEKDFEKPNNPYLTVNATSKDEAGFFCNIAFWTTLGDEANDIKIGTVLSLEEAGTMLLEKNI
MLVTPTVGGRKGLSTKDKILEYRNSLLTRGRIVTIADIKAYGLNHFKNTITKIEVKKGTKKESSTKEGFA
RTIDIYLYKNTEITEIMKESEWHYLCDSFLINLKKASSNVYPYTLNTI
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|386262266|ref|NC_016510.2|:c2280280-2278454 Flavobacterium columnare ATCC 49512 chromosome, complete genome
ATGAATCAAGAACGCATAAAAGATCGTATTTTAAGAAAAGCATCTAGACTATGGGGCTTTAATGAATTAC
AAACAGAATCATCATTTGACCCTATCATTGGATTATTACTAACTGCTTGTGCTTCAGAATTAGAAAAATT
AAATACTGATTTAGAAGATTCTAGGTCAAGAATAATTGAAAGAGTATTAGACCTCATGTTTCCAGAAGAA
GTATCAGGGGTAACTCCGTCCAGTGCTGTTGTTCAGTTATTTCCTACAGAAAACAACGTAAAAATATCAA
AATACAATCAGTTTAAAGGAACTAAAAAAATTACCAATATTTATAATCCTACTGAAGTTTTACATAAAGA
TGTCTTTTTTGGCCCTACAATAGAAACCACACTAACTACAGCTAAAGTAGAATATTTAGCGTATGGAAAC
TCTTTAAAAAAAATTGATAATTTCTTTTTTAACGATATTATTAGTACCTCCAATAATTTTATTCCTAAAG
GAGAATTATGGATAGGACTAAAGTGTTCTGATACCGAAAACATCATAAATCCAACGTTTTATATCAACAT
TAATAACAGTTATCAAAAAGATTTATTCTTCTACTATTTACGACAAGCTAAAATATACTTTGGAAATCAA
GAATTCACTTTTAATGAAGGGTATAATGCTGCGGAAGAAAACTTTAATTTTGAAAATATTGTTAGTAAAA
ATTACTCCAATCTAGATCAAATAAACAATAGGGTTAATAGTTTTTATTTGCCCAACTTTTTTACCCTAAG
CGGCACTATTAATCATGCTGAAAAAACAGATTCAGACACCTTGTTTCAACACTATTTTCTAGATCATAAA
TTAGAAGACGATAAGTCTATTATATGGCTACGAGTTGAATTAACCGAAACAATAGGAAATGATGTTCTAG
AAAATGTATCTGTAAATCTGAACTGTTTACCCGTAGTAAACAAAAGGATTTCAAGAGCATCTCATAGAGT
TACAGGAGCTCTAAACATAGTTCCTATAGATTCCGATGAATTTTTCTTAGACCTAGATTATGTTTCAAAT
GACGAAGGCTATCGTTACGATTTAAGAAATTACAATGATAATAAATCCGGAACCGTTACACTCAGACACG
GAGGCGTTTCTCGTTTTGACCAAAGAAGAGCATCTGATCTCTTACAACAACTCCTAGAACTTATTAAAGA
TGAAACCGCTTCTTTTATGAGCATAGGAAACGATGCAACCAGAGAAACTCTAAAACAAATTAACCAAAAT
GTTGCCGCTTTGTATCAACTATCCAAAGAAAAAGATTTTGAAAAACCCAATAATCCCTACCTAACCGTTA
ATGCTACATCTAAAGACGAAGCTGGTTTCTTTTGTAATATAGCCTTTTGGACAACTTTAGGAGATGAGGC
AAATGATATCAAAATTGGTACCGTTTTATCCTTAGAAGAAGCAGGAACTATGCTCTTAGAAAAAAACATC
ATGTTAGTAACTCCAACCGTTGGTGGAAGAAAAGGACTGTCTACTAAAGATAAAATACTCGAATACAGAA
ACTCCTTACTAACCCGAGGAAGAATTGTAACAATAGCTGACATTAAAGCCTATGGACTAAACCACTTTAA
AAATACAATTACAAAAATTGAAGTAAAAAAAGGAACTAAAAAAGAAAGCTCTACAAAAGAAGGTTTTGCC
AGAACAATAGATATCTATCTATATAAAAACACAGAAATAACCGAAATAATGAAAGAATCTGAATGGCACT
ATTTATGCGATAGCTTTTTAATTAATCTTAAAAAAGCATCCTCAAATGTATACCCTTATACCCTAAACAC
CATCTAA